DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and Syt9

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_038944965.1 Gene:Syt9 / 60564 RGDID:621169 Length:566 Species:Rattus norvegicus


Alignment Length:505 Identity:167/505 - (33%)
Similarity:247/505 - (48%) Gaps:100/505 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDASV-MDTIVPAILGLTAAAVLSSVAC-ICARQMRLR-----NKKQSQHDASFPFQPTRRPTAV 64
            ||.|| :.|:|....||....|...|:. :|....|.|     :|..:|.    |...|...|..
  Rat    48 PDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQE----PLNYTDTETNE 108

  Fly    65 RSPSG---QPPHYLKKSPSPTGGKQMGLLSPMQDQSTSPIAQPNVKYS-------EEGDGPAQH- 118
            :..|.   .||     :|.|....::...||....||.|..|.|..::       .|....|:| 
  Rat   109 QENSEDFLDPP-----TPCPDSSMKISHTSPDIPLSTQPGGQDNCAHAVRVQRQVTEPTPSARHN 168

  Fly   119 ---------------AEQQNGNQLTVVDGNG-LKHSLHNSLHHSPVETIANGSVTITLDDHSLTN 167
                           .:.|...|||   |.| :|..|:..      .::.|       ||...:|
  Rat   169 SIRRQLNLSNPDFNIQQLQRQEQLT---GIGRIKPELYKQ------RSLDN-------DDGRRSN 217

  Fly   168 GKELTVTDQYGKLGTIYFKLRYLAERNALMVSIIRCRGLPCKGGSSGTGDIPTGMNGRTQAATDP 232
            .|..      |||.   |.|:|..:...|:|.|.:...||.| ..|||              :||
  Rat   218 SKAC------GKLN---FILKYDCDLEQLIVKIHKAVNLPAK-DFSGT--------------SDP 258

  Fly   233 YVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFTFYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEV 297
            |||:.||||::.|.:|:|.|.|.|||:||.|.| .::.|||:...|||.:..|||:||.|:||:|
  Rat   259 YVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLF-PVHYNDLEARKLHFSVYDFDRFSRHDLIGQV 322

  Fly   298 VCPLTSIEIGDISKEALSISKEIQ---PRSLKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLP 359
            |.. ...::.|..:|.: :.|:|:   ..::.:     |||:.|||:.|.|||||:.::|||||.
  Rat   323 VVD-HFFDLADFPRECI-LWKDIEYVTNDNVDL-----GELMFSLCYLPTAGRLTITIIKARNLK 380

  Fly   360 RMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELM 424
            .||:||.:|||||:.|:.:|:|:.|:||..|:.||:||:||:..||:|.     .|::.:.|.:.
  Rat   381 AMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPP-----ESIDQIHLSIA 440

  Fly   425 LLDWDRVTKNEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWHKLNE 474
            ::|:|||..|||||..::|. .:.....:||:|:.:.||:.||.||.|.|
  Rat   441 VMDYDRVGHNEVIGVCQVGN-EAERLGRDHWSEMLSYPRKPIAHWHSLLE 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 55/145 (38%)
C2B_Synaptotagmin-4 332..473 CDD:176049 63/140 (45%)
Syt9XP_038944965.1 C2 221..345 CDD:417471 56/150 (37%)
C2B_Synaptotagmin-3-5-6-9-10 354..487 CDD:176048 63/138 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X61
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.