DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and Doc2g

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_068563.2 Gene:Doc2g / 60425 MGIID:1926250 Length:387 Species:Mus musculus


Alignment Length:327 Identity:95/327 - (29%)
Similarity:152/327 - (46%) Gaps:52/327 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 TDQYGKLGTIYFKLRYLAERNALMVSIIRCRGL-PCKGGSSGTGDIPTGMNGRTQAATDPYVKLQ 237
            :|....|||:.|.|.:..:.:||..:..|.:|| |...||                 .|.|||..
Mouse    78 SDDSTALGTLEFTLLFDEDNSALHCTAHRAKGLKPPAAGS-----------------VDTYVKAN 125

  Fly   238 LLP--DKQHKVKTRVVRNTRNPVYDEDFTFYGLNMNDLQNMSLHFVILS---FDRYSRDDVIGEV 297
            |||  .|..:::||.||.||.||::|..|::|....|....:|...:..   ..|..|...:||:
Mouse   126 LLPGASKASQLRTRTVRGTREPVWEETLTYHGFTCQDAGRKTLRLCVCEDSRLRRRRRGPPLGEL 190

  Fly   298 VCPLTSI-----EIGDISKEALSISKEIQPRSL----------------KIRAQGRGELLISLCW 341
            ..||..:     ...||..|...::|  :|:||                ::..:.||.:|:|||:
Mouse   191 RVPLRKLVPNRARSFDICLEKRKLTK--RPKSLDTARGMSLYEEEEMEAEVFGEERGRILLSLCY 253

  Fly   342 QPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFAFDI 406
            ....|.|.|.:|:..:|..||..|.:||:|:::|..:..:.:|.||.|:::||:|.|||.|.:  
Mouse   254 SSERGGLLVGVLRCVHLAPMDANGYSDPFVRLFLHPSSGKKSKYKTSVRRKTLNPEFNEEFFY-- 316

  Fly   407 PAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWHK 471
               .|....|...:|.:.:.|:|..|.::.||.::|.| .:|...|.||.|.......::..||.
Mouse   317 ---AGHREELAQKALLVSVWDYDLGTADDFIGGVQLSG-RASGERLRHWRECLGHCDHRLELWHL 377

  Fly   472 LN 473
            |:
Mouse   378 LD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 44/153 (29%)
C2B_Synaptotagmin-4 332..473 CDD:176049 46/140 (33%)
Doc2gNP_068563.2 C2A_Rabphilin_Doc2 84..209 CDD:176000 42/141 (30%)
C2 246..378 CDD:301316 44/137 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.