DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and Syt10

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_061273.1 Gene:Syt10 / 54526 MGIID:1859546 Length:523 Species:Mus musculus


Alignment Length:419 Identity:143/419 - (34%)
Similarity:211/419 - (50%) Gaps:74/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QDQSTSPIA-QPNVKYSEEGDGPAQHAEQQNGNQLTVVDGNGLKH-------------SLHNSLH 144
            :::..:|.| :|.:|.|.  ..|...||.|     |.:..:.:||             |.|||..
Mouse   118 ENEKPAPKAIEPAIKISH--TSPDIPAEVQ-----TALKEHLIKHARVQRQTTEPTSSSRHNSFR 175

  Fly   145 HSPVETIANGSVTITLDDHSLTNGKELTVT---------------------DQYGKLGTIYFKLR 188
            ......:...||..::....:....|...:                     |.....|.:.|.|:
Mouse   176 RHLPRQMNVSSVDFSVGTEPILQRGETRTSIGRIKPELYKQKSVDSEGNRKDDVKTCGKLNFALQ 240

  Fly   189 YLAERNALMVSIIRCRGLPCKGGSSGTGDIPTGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRN 253
            |..|...|:|.||:...||.| ..:||              :|||||:.||||::.|.:|||.|.
Mouse   241 YDYENELLVVKIIKALDLPAK-DFTGT--------------SDPYVKIYLLPDRKKKFQTRVHRK 290

  Fly   254 TRNPVYDEDFTFYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEVVCPLTSIEIGDISKEALSISK 318
            |.||::||.|.| .:..:.|.|..|||.|..|||:||.|:||||:.. ...|:.|:|:|| ::.|
Mouse   291 TLNPLFDELFQF-PVVYDQLSNRKLHFSIYDFDRFSRHDMIGEVILD-NLFEVSDLSREA-TVWK 352

  Fly   319 EIQ---PRSLKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQ 380
            :|.   ..|:.:     ||::.|||:.|.|||:|:.::|.|||..||:||.:|||||:.|:..|:
Mouse   353 DIHCATTESIDL-----GEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGR 412

  Fly   381 RIAKKKTHVKKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGP 445
            |:.|:||..||.||:||:||:..||||.     .:::.|||.:.::|:|||..|||||.... |.
Mouse   413 RLKKRKTTTKKNTLNPVYNEAIIFDIPP-----ENVDQVSLCIAVMDYDRVGHNEVIGVCRT-GL 471

  Fly   446 NSSSTALNHWNEVCNSPRRQIAEWHKLNE 474
            ::.....:||||:....|:.|..||.|.|
Mouse   472 DAEGLGRDHWNEMLAYHRKPITHWHPLLE 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 58/145 (40%)
C2B_Synaptotagmin-4 332..473 CDD:176049 62/140 (44%)
Syt10NP_061273.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 13..35
C2A_Synaptotagmin-1-5-6-9-10 231..356 CDD:176031 58/142 (41%)
C2B_Synaptotagmin-3-5-6-9-10 365..498 CDD:176048 62/138 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X61
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.