Sequence 1: | NP_477464.1 | Gene: | Syt4 / 40876 | FlyBaseID: | FBgn0028400 | Length: | 474 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254131.1 | Gene: | DH11.5 / 3565199 | WormBaseID: | WBGene00008438 | Length: | 825 | Species: | Caenorhabditis elegans |
Alignment Length: | 239 | Identity: | 52/239 - (21%) |
---|---|---|---|
Similarity: | 92/239 - (38%) | Gaps: | 66/239 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 271 NDLQNMSLHFVILSFDRY--SRDDVIGEVVCPLTSIEIGDISKEALSISKEIQPRSLKIRAQGR- 332
Fly 333 GELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSP- 396
Fly 397 ----------------------------VFNESFAFDIPAAEGAGASLEGVSLELMLLDWD---- 429
Fly 430 -RVTKNEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWHKL 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Syt4 | NP_477464.1 | C2A_Synaptotagmin-4-11 | 179..322 | CDD:176034 | 11/52 (21%) |
C2B_Synaptotagmin-4 | 332..473 | CDD:176049 | 40/176 (23%) | ||
DH11.5 | NP_001254131.1 | C2B_Synaptotagmin | 671..822 | CDD:175975 | 39/171 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000025 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |