DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and DH11.5

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001254131.1 Gene:DH11.5 / 3565199 WormBaseID:WBGene00008438 Length:825 Species:Caenorhabditis elegans


Alignment Length:239 Identity:52/239 - (21%)
Similarity:92/239 - (38%) Gaps:66/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 NDLQNMSLHFVILSFDRY--SRDDVIGEVVCPLTSIEIGDISKEALSISKEIQPRSLKIRAQGR- 332
            ||.|.....|.....||.  :.::.:.|.:|        ..|.||::::......:..:...|. 
 Worm   613 NDDQGARTAFECDFEDRVLATEEETLQEKLC--------RTSPEAMNLNALYAAANKAVSCGGDV 669

  Fly   333 GELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSP- 396
            .|||..|.:.|....:|..:.||:.||..:.     |:.:| :|:.|:|:.::    |:.|::| 
 Worm   670 CELLTILTYAPTVQFVTTTVKKAKALPYNNA-----PFARI-MLFEGRRLMEQ----KQTTVNPS 724

  Fly   397 ----------------------------VFNESFAFDIPAAEGAGASLEGVSLELMLLDWD---- 429
                                        .|:|||.|.:|..:     |:...:.:.|.|.|    
 Worm   725 LVHKSSVDGSKPSSSSASTSSNDNPSDVSFSESFLFHVPPTK-----LDRSHIVIELYDHDDEGG 784

  Fly   430 -RVTKNEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWHKL 472
             :...:.|||||..|..|:      ||.::.......:..|||:
 Worm   785 LQKIGHCVIGRLVDGTGNA------HWIQMVRQHGLPVCMWHKI 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 11/52 (21%)
C2B_Synaptotagmin-4 332..473 CDD:176049 40/176 (23%)
DH11.5NP_001254131.1 C2B_Synaptotagmin 671..822 CDD:175975 39/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.