DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and PLA2G4D

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_828848.3 Gene:PLA2G4D / 283748 HGNCID:30038 Length:818 Species:Homo sapiens


Alignment Length:105 Identity:40/105 - (38%)
Similarity:56/105 - (53%) Gaps:16/105 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 RGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSP 396
            :||  .|.|||     |||.:|:||||...|:...|||||.:.|  :.....|.||.....|..|
Human    15 QGE--ASTCWQ-----LTVRVLEARNLRWADLLSEADPYVILQL--STAPGMKFKTKTLTDTSHP 70

  Fly   397 VFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEV 436
            |:||:|.|.|.      :.::.| |||.:.|.|.||::::
Human    71 VWNEAFRFLIQ------SQVKNV-LELSIYDEDSVTEDDI 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034
C2B_Synaptotagmin-4 332..473 CDD:176049 40/105 (38%)
PLA2G4DNP_828848.3 C2_cPLA2 23..141 CDD:176001 35/95 (37%)
cPLA2_Grp-IVB-IVD-IVE-IVF 269..811 CDD:132840
Substrate binding. /evidence=ECO:0000269|PubMed:27220631, ECO:0007744|PDB:5IXC, ECO:0007744|PDB:5IZR 330..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.