DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and Sytl1

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_113570.2 Gene:Sytl1 / 269589 MGIID:1933365 Length:568 Species:Mus musculus


Alignment Length:455 Identity:125/455 - (27%)
Similarity:193/455 - (42%) Gaps:77/455 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RNKKQSQHDASFPFQPTRRPTAVRSPSGQPPHYLKKSPSP-TGGKQMGLLSPMQDQSTSPIAQPN 105
            ||.:....|...|:.|::   |......:|.....:..:| .||.|:....|..|        |.
Mouse   149 RNTETQGPDLFSPYVPSK---ASEGQEEEPQDQECELEAPGEGGVQVAEADPELD--------PE 202

  Fly   106 VKYSEEGD-GPAQHAEQ----QNGNQLTVVDGNGLKHSLHNSLHHSPVETIANGSVTITLDDHSL 165
            .|..:|.. .|||....    :||.     :..||..||...|..|...:..|.| |::....||
Mouse   203 QKAEQESQPTPAQSKATSKILENGE-----EAPGLGPSLDRMLSSSSSVSSLNSS-TLSGSLMSL 261

  Fly   166 TNGKEL-TVTDQYGKLGTIYFKLRYLAERNALMVSIIRCRGLPCKGGSSGTGDIPTGMNGRTQAA 229
            :...|. ||..:    |::.|.|||....:.|.|.:|:|:||.                ...:..
Mouse   262 SGEAEAGTVQVR----GSVLFSLRYEPGTSELRVQVIQCQGLA----------------AARRRR 306

  Fly   230 TDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFTFYGLNMNDLQNMSLHFVILSFDRYSRDDVI 294
            :|||||..||||||.|.||.|.:...||:::|... :.:...||....|...:...:...|:..:
Mouse   307 SDPYVKSYLLPDKQSKRKTSVKKRNLNPIFNETLR-HSVQQADLPGRVLSLSVWHRESLGRNIFL 370

  Fly   295 GEVVCPLTSIEIGDISKEA--LSISKEIQPRSLKIRAQGRGELLISLCW---------QPAAGRL 348
            |||..||   :..:...||  |.:...:.|...::  ..||.|.:||.:         ||.:|.|
Mouse   371 GEVEVPL---DTWNWDSEATWLPLQPRVPPSPDEL--PSRGLLSLSLKYVPAGSEGGGQPQSGEL 430

  Fly   349 TVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFAFDIPAAEGAG 413
            ...:.:|::|..:. .|..|.|::..:|.:..|.::::|.|.:|:||||||.:..:|     |.|
Mouse   431 HFWVKEAQSLVPLR-PGSLDTYIQCSVLPDDSRASRQRTRVVRRSLSPVFNHTMVYD-----GFG 489

  Fly   414 -ASLEGVSLELMLLDWDRVTKNEVIG-RLELGGPNSSSTALN-HWNEVCNSP-RRQIAEWHKLNE 474
             |.|.....||.|.|...:...::.| ||.||  ..||..|. .|.:  ::| .:|:  |..|.|
Mouse   490 PADLRQACAELSLWDHGALASRQLGGTRLSLG--TGSSYGLQVPWMD--STPEEKQL--WQTLLE 548

  Fly   475  474
            Mouse   549  548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 41/144 (28%)
C2B_Synaptotagmin-4 332..473 CDD:176049 46/153 (30%)
Sytl1NP_113570.2 PHD_SF 35..>99 CDD:389947
NESP55 <92..230 CDD:115071 21/96 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..255 30/122 (25%)
C2 273..392 CDD:387358 41/142 (29%)
C2B_SLP_1-2-3-4 405..561 CDD:175987 48/156 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.