DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and D2023.3

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001256374.1 Gene:D2023.3 / 183945 WormBaseID:WBGene00008407 Length:222 Species:Caenorhabditis elegans


Alignment Length:215 Identity:45/215 - (20%)
Similarity:85/215 - (39%) Gaps:35/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 DRYSRDDVIGEVVCPLTSIEI----GDISKEALSISKEIQP------------RSLKIRAQGR-- 332
            |..|..:...:.|...:|:||    |..|...|.:|..:..            ||..:.|.||  
 Worm    12 DSRSSSESSSDAVTQKSSLEIHSLGGATSPSLLPVSPSMHSNGISRGHNGDSRRSSMVDATGRFC 76

  Fly   333 -------GELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYN-GQRIAKKKTHV 389
                   .|:|:.||:......::|.:.||.:| ..|.....|.:::|..|.. ...:::.||..
 Worm    77 SQPMSGSPEILVGLCYDDKHEVVSVCIEKASSL-GSDTAHPPDSFIRIIGLDEFSTELSRHKTDT 140

  Fly   390 KKRTLSPVFNE--SFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTAL 452
            .|.:..||::.  :..|.....|.:...:|..::..:|      .:...||.:.:|..:|:..|.
 Worm   141 VKHSTQPVYSHHCTMRFSKDKVETSTVRVEVWTVTGIL------RRKVQIGSISIGFASSTPDAN 199

  Fly   453 NHWNEVCNSPRRQIAEWHKL 472
            .||.::.......:::||.:
 Worm   200 EHWQQMMQGAGITVSKWHAI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 10/39 (26%)
C2B_Synaptotagmin-4 332..473 CDD:176049 31/153 (20%)
D2023.3NP_001256374.1 C2 84..219 CDD:387358 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.