DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and Y48G8AR.2

DIOPT Version :10

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_490838.3 Gene:Y48G8AR.2 / 171702 WormBaseID:WBGene00021693 Length:339 Species:Caenorhabditis elegans


Alignment Length:99 Identity:22/99 - (22%)
Similarity:30/99 - (30%) Gaps:33/99 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PAILG-------LTAAAVLSSVACICARQMRLRNKKQSQHDASFPFQPTRRPTAVRSPSGQ---P 71
            ||:.|       ||..|:.:|...:                      |...|..|:|..|.   .
 Worm   193 PAVKGKAPYKRNLTLPAIQTSYLSV----------------------PDEEPGLVQSAGGNSNFS 235

  Fly    72 PHYLKKSPSPTGGKQMGLLSPMQDQSTSPIAQPN 105
            |.:...||||...:.....:.......|| |.||
 Worm   236 PKFWGGSPSPRSPRSFSSANSSNISINSP-AAPN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034
C2B_Synaptotagmin-4 332..473 CDD:176049
Y48G8AR.2NP_490838.3 PHD_SF 15..159 CDD:473978
FYVE_Slp3_4_5 95..148 CDD:277286
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.