DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt4 and LOC100497338

DIOPT Version :9

Sequence 1:NP_477464.1 Gene:Syt4 / 40876 FlyBaseID:FBgn0028400 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_002938753.2 Gene:LOC100497338 / 100497338 -ID:- Length:398 Species:Xenopus tropicalis


Alignment Length:303 Identity:79/303 - (26%)
Similarity:142/303 - (46%) Gaps:48/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 GTIYFKLRYLAERNALMVSIIRCRGLPCKGGSSGTGDIPTGMNGRTQAATDPYVKLQLLPDKQ-- 243
            |.:...|.|..::.||::::|....||..                   :.||:|::::.....  
 Frog   131 GKLKLSLYYDKKKMALLINVIEATDLPAH-------------------SHDPFVRIKVFSKADDP 176

  Fly   244 --------HKVKTRVVRNTRNPVYDEDFTFYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEVVCP 300
                    |:..|:||:|:||||:.|.|| ..|..:.|.:.||.|.:..||:|||..:|||....
 Frog   177 HSSVQTIIHEWDTKVVKNSRNPVFVESFT-CTLKESQLLSTSLKFEVKDFDKYSRHTLIGETRAT 240

  Fly   301 LTSIEIGDISKEALSISKEIQPRSLKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTG 365
            |..::    :.:.|.:.:::|.::    ....||:||||...|.|.::.|.:||.:. ..:....
 Frog   241 LQGLK----TSKTLELYEDLQE
KT----KDAIGEVLISLKCLPTAQKIEVGILKFKT-SSLSTIS 296

  Fly   366 LADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDR 430
            ..|.|.:|.:..|..:...:|:.::.::...||||:|.|.:| ..|....|..|||      ::.
 Frog   297 ERDVYARIDVFTNQHKQKHQKSSLRAKSKVTVFNETFLFGLP-DPGKTHCLILVSL------YET 354

  Fly   431 VTK-NEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWHKL 472
            :.. .::||:..||..|:.:.. .||..:..:.|:.:|:||.|
 Frog   355 IASGRKLIGQTSLGNQNTKAED-GHWELMMQTLRQPVAKWHPL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt4NP_477464.1 C2A_Synaptotagmin-4-11 179..322 CDD:176034 38/150 (25%)
C2B_Synaptotagmin-4 332..473 CDD:176049 40/142 (28%)
LOC100497338XP_002938753.2 C2 129..258 CDD:417471 38/150 (25%)
C2 265..396 CDD:417471 39/139 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.