Sequence 1: | NP_649713.1 | Gene: | CG10050 / 40873 | FlyBaseID: | FBgn0037492 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_568814.2 | Gene: | AT5G54880 / 835579 | AraportID: | AT5G54880 | Length: | 394 | Species: | Arabidopsis thaliana |
Alignment Length: | 327 | Identity: | 66/327 - (20%) |
---|---|---|---|
Similarity: | 94/327 - (28%) | Gaps: | 157/327 - (48%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 RRNKCEKCKRPVVVCWCPALPHPPEAVSSQIVILQHPAEEKRSLRTALMLQLGLE-PGKCVVYK- 81
Fly 82 ---------------GKRFPNHR--------------------------------------NHAD 93
Fly 94 LQ--------------------------------------------------------------R 96
Fly 97 ILDSPQTL----------------------------LLYPSRDSVPL------EEVDHSAGPYTL 127
Fly 128 VLIDGTWPQAKAIYASSPALHRLR-QVKLIAVGISDY-IIRTQPTEGCLSTLETAAQCLAVLESR 190
Fly 191 PE 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10050 | NP_649713.1 | DTW | 20..209 | CDD:281875 | 66/326 (20%) |
AT5G54880 | NP_568814.2 | DTW | <275..383 | CDD:281875 | 37/96 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 1 | 1.000 | 94 | 1.000 | Domainoid score | I2550 |
eggNOG | 1 | 0.900 | - | - | E1_COG3148 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 94 | 1.000 | Inparanoid score | I2233 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D910985at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0005667 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.870 |