DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10050 and AT5G54880

DIOPT Version :9

Sequence 1:NP_649713.1 Gene:CG10050 / 40873 FlyBaseID:FBgn0037492 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_568814.2 Gene:AT5G54880 / 835579 AraportID:AT5G54880 Length:394 Species:Arabidopsis thaliana


Alignment Length:327 Identity:66/327 - (20%)
Similarity:94/327 - (28%) Gaps:157/327 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRNKCEKCKRPVVVCWCPALPHPPEAVSSQIVILQHPAEEKRSLRTALMLQLGLE-PGKCVVYK- 81
            :|..|..|.:|..:|.|..:..|.......|.||||..|.|.:|.:..:.:|||: .|...|:. 
plant    44 KRPTCPSCDKPSQLCLCKKMRSPCFDNQVSITILQHSLERKHALNSTRIARLGLKNVGVTTVFDV 108

  Fly    82 ---------------GKRFPNHR--------------------------------------NHAD 93
                           .|...||.                                      :|..
plant   109 HDEAEFLIRVIGSGCSKIDTNHLDSEYRVENVASLELDDSFKLGSSGNVENLESEKNVVLVDHGS 173

  Fly    94 LQ--------------------------------------------------------------R 96
            |:                                                              .
plant   174 LEIAESLNLSQHLSEISYRDSRVRDKIGSYEEDLIKICMKKHGVISNVSHSLMLETNVKVLSFDH 238

  Fly    97 ILDSPQTL----------------------------LLYPSRDSVPL------EEVDHSAGPYTL 127
            ||.||..:                            ||:||.:||.:      ||:.    ...|
plant   239 ILASPAAMDVLAKGFMVTKFSEGKQEFELEVPPGSALLFPSEESVKINYLKEKEELK----VRNL 299

  Fly   128 VLIDGTWPQAKAIYASSPALHRLR-QVKLIAVGISDY-IIRTQPTEGCLSTLETAAQCLAVLESR 190
            :::||||.:|:.||..:|.|..|| .|||...|.|.| .:|.||..|||||:|:....:..:...
plant   300 IVLDGTWSKARRIYLENPWLKLLRCHVKLEIEGTSLYKEVRRQPRAGCLSTIESIVYAMKEIGED 364

  Fly   191 PE 192
            ||
plant   365 PE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10050NP_649713.1 DTW 20..209 CDD:281875 66/326 (20%)
AT5G54880NP_568814.2 DTW <275..383 CDD:281875 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2550
eggNOG 1 0.900 - - E1_COG3148
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2233
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910985at2759
OrthoFinder 1 1.000 - - FOG0005667
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.