DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10050 and AT2G41750

DIOPT Version :9

Sequence 1:NP_649713.1 Gene:CG10050 / 40873 FlyBaseID:FBgn0037492 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_181706.2 Gene:AT2G41750 / 818774 AraportID:AT2G41750 Length:264 Species:Arabidopsis thaliana


Alignment Length:269 Identity:69/269 - (25%)
Similarity:110/269 - (40%) Gaps:62/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDDAWLDLVGISADPPNRRNKCEKCKRPVVVCWCPALPHPPEAVSSQIVILQHPAEEKRSLRTA 65
            |||:         .|..:||..|:.|.||..:|.|..||......:::|:||.||.|.:..|.|.
plant    12 MEDE---------QDAHHRRQICDNCDRPNAICLCHVLPADLIPTNTEIIILHHPHESRHKLNTT 67

  Fly    66 LMLQLGLEPGKCVVYKGKRFPNH---RNHADLQ--RILDSPQTLLLYPSRDSVP---------LE 116
            .:|...|       ....|.|..   |.|....  ..|.:|.|:.|:||..|.|         |.
plant    68 PLLTKSL-------LNVTRIPARRLLRRHISTAGGTALPAPPTIYLFPSSPSSPAVTISEFKSLN 125

  Fly   117 EVDH----SAGPYTLVLIDGTWPQAKAIYASSPALHRLRQVKLIAVGI---------------SD 162
            .::|    :..|..|::.|.||..||.:..:|..:  ||:...:.|.:               |:
plant   126 LLNHREISNPPPLRLIVFDATWKHAKEMVKASEVV--LREAGAVRVCLDTEIDASVSGGTIYDSE 188

  Fly   163 YIIRTQPTEGCLSTLETAAQCLAVLE-SRPELRQTLVRPLHTLCKYQLDNGAVEHQSKEFLLKNN 226
            .::|.:|..||::|.|..|:||..:| ...|:.:.|:..|..:.::|          .::|....
plant   189 LVLRKEPFGGCVTTAEAVARCLGAIEPDGEEIERKLISVLKEMVRFQ----------SKYLKPMK 243

  Fly   227 QYPKPIGKR 235
            ..||.:.||
plant   244 PRPKLLKKR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10050NP_649713.1 DTW 20..209 CDD:281875 58/222 (26%)
AT2G41750NP_181706.2 DTW 22..235 CDD:397847 58/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3148
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H79701
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58133
OrthoDB 1 1.010 - - D910985at2759
OrthoFinder 1 1.000 - - FOG0005667
OrthoInspector 1 1.000 - - oto2934
orthoMCL 1 0.900 - - OOG6_105506
Panther 1 1.100 - - LDO PTHR21392
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.