DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10050 and Dtwd2

DIOPT Version :9

Sequence 1:NP_649713.1 Gene:CG10050 / 40873 FlyBaseID:FBgn0037492 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006526275.1 Gene:Dtwd2 / 68857 MGIID:1916107 Length:556 Species:Mus musculus


Alignment Length:223 Identity:99/223 - (44%)
Similarity:132/223 - (59%) Gaps:8/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RPVVVCWCPALPHPPEAVSSQIVILQHPAEEKRSLRTALMLQLGLEPGKCVVYKGKRFPNHRNHA 92
            ||..||.||.||..|..:|:.:.|:||||||.|.|||..:|...|.|.:|.|..|:||...|: .
Mouse   332 RPQKVCLCPYLPVRPLQISTHLYIIQHPAEESRVLRTVPLLAACLPPDRCTVKIGRRFSEERD-V 395

  Fly    93 DLQRILDSPQTLLLYPSRDSVPLEE--VDHSAGPYTLVLIDGTWPQAKAIYASSPALHRLRQVKL 155
            :|..:.....||:|||..::..|||  :|....|.|::||||||.|||.|:..:......:||:|
Mouse   396 ELATVCRDSGTLILYPGAEATNLEEFILDSPVYPSTIILIDGTWSQAKDIFYKNSLFRLPKQVQL 460

  Fly   156 IAVGISDYIIRTQPTEGCLSTLETAAQCLAVLESRPELRQTLVRPLHTLCKYQLDNGAVEHQSKE 220
            .....|.|:||.|||..||||||.||..|::||....:::||:|||..||.:||.:||....|||
Mouse   461 KTSVCSQYVIRMQPTNRCLSTLECAAVALSILEKNNCIQETLLRPLQALCSFQLQHGAQIRLSKE 525

  Fly   221 FLLKNNQYPKPIGK-----RLSRLLRNT 243
            :||:|..||||:.|     |...||.|:
Mouse   526 YLLRNGLYPKPMPKNKRKLRKMELLMNS 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10050NP_649713.1 DTW 20..209 CDD:281875 80/182 (44%)
Dtwd2XP_006526275.1 DTW 331..510 CDD:377168 78/178 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833564
Domainoid 1 1.000 157 1.000 Domainoid score I4171
eggNOG 1 0.900 - - E1_COG3148
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H79701
Inparanoid 1 1.050 190 1.000 Inparanoid score I3885
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58133
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005667
OrthoInspector 1 1.000 - - oto94272
orthoMCL 1 0.900 - - OOG6_105506
Panther 1 1.100 - - LDO PTHR21392
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10123
SonicParanoid 1 1.000 - - X6102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.