DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10050 and dtwd2

DIOPT Version :9

Sequence 1:NP_649713.1 Gene:CG10050 / 40873 FlyBaseID:FBgn0037492 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001016607.1 Gene:dtwd2 / 549361 XenbaseID:XB-GENE-5735070 Length:276 Species:Xenopus tropicalis


Alignment Length:235 Identity:105/235 - (44%)
Similarity:140/235 - (59%) Gaps:7/235 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GISADP----PNRRNKCEKCKRPVVVCWCPALPHPPEAVSSQIVILQHPAEEKRSLRTALMLQLG 71
            |:||.|    .:||..|.:|.||..||.||.||..|..||:.:.|:||||||.|.|||..:|...
 Frog    31 GLSALPVENSTDRRALCARCSRPQKVCLCPFLPVCPLDVSTSLYIVQHPAEEGRVLRTVPLLAAC 95

  Fly    72 LEPGKCVVYKGKRFPNHRNHADLQRILDSPQTLLLYPSRDSVPLEEVDHS--AGPYTLVLIDGTW 134
            |...||.|..|:||...| :.:|..:..:|.|.:|||..::..|||:..:  ..||.|::|||||
 Frog    96 LPHEKCKVLIGRRFGEER-YPELATVCRNPGTFILYPGAEAANLEEMSLADIQPPYALIIIDGTW 159

  Fly   135 PQAKAIYASSPALHRLRQVKLIAVGISDYIIRTQPTEGCLSTLETAAQCLAVLESRPELRQTLVR 199
            .|||.|:..:......:||:|.....|.|:||||||..||||||.||..|:|:|.|.|:::.::|
 Frog   160 SQAKDIFYKNTLFRLPKQVQLKTPISSQYVIRTQPTNMCLSTLECAAAALSVMEKRTEIQEIILR 224

  Fly   200 PLHTLCKYQLDNGAVEHQSKEFLLKNNQYPKPIGKRLSRL 239
            ||..||.:||.:||..|.|||.|||...|.||:.|...:|
 Frog   225 PLQALCSFQLQHGAQIHHSKEHLLKTGLYNKPMPKNKRKL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10050NP_649713.1 DTW 20..209 CDD:281875 84/190 (44%)
dtwd2NP_001016607.1 DTW 44..230 CDD:377168 82/186 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4156
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H79701
Inparanoid 1 1.050 185 1.000 Inparanoid score I3822
OMA 1 1.010 - - QHG58133
OrthoDB 1 1.010 - - D429011at33208
OrthoFinder 1 1.000 - - FOG0005667
OrthoInspector 1 1.000 - - oto104477
Panther 1 1.100 - - LDO PTHR21392
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10123
SonicParanoid 1 1.000 - - X6102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.