DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10050 and Dtwd2

DIOPT Version :9

Sequence 1:NP_649713.1 Gene:CG10050 / 40873 FlyBaseID:FBgn0037492 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001101901.1 Gene:Dtwd2 / 361326 RGDID:1306423 Length:298 Species:Rattus norvegicus


Alignment Length:239 Identity:105/239 - (43%)
Similarity:140/239 - (58%) Gaps:7/239 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDAWLDLVGISADPPNRRNKCEKCKRPVVVCWCPALPHPPEAVSSQIVILQHPAEEKRSLRTALM 67
            |..|    |:..:...||.:|.:|.||..||.||.||..|..:|:.:.|:||||||.:.|||..:
  Rat    53 DGLW----GLPVEHAERRPECSRCSRPQKVCLCPYLPVRPLQISTHLYIIQHPAEESKVLRTVPL 113

  Fly    68 LQLGLEPGKCVVYKGKRFPNHRNHADLQRILDSPQTLLLYPSRDSVPLEE--VDHSAGPYTLVLI 130
            |...|.|.||.|..|:||...|: .:|..:.....||:|||..::..|||  :|....|.|::||
  Rat   114 LAACLPPDKCTVKIGRRFSEERD-IELSTVCRDSGTLILYPGAEATNLEEFILDAPVYPSTIILI 177

  Fly   131 DGTWPQAKAIYASSPALHRLRQVKLIAVGISDYIIRTQPTEGCLSTLETAAQCLAVLESRPELRQ 195
            ||||.|||.|:..:......:||:|.....|.|:||.|||..||||||.||..|:|||....:::
  Rat   178 DGTWSQAKDIFYKNSLFRLPKQVQLKTSICSQYVIRMQPTNRCLSTLECAAAALSVLEKNSCIQE 242

  Fly   196 TLVRPLHTLCKYQLDNGAVEHQSKEFLLKNNQYPKPIGKRLSRL 239
            ||:|||..||.:||.:||....|||:||||..||||:.|...:|
  Rat   243 TLLRPLQALCSFQLQHGAQVRLSKEYLLKNGLYPKPMPKNKRKL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10050NP_649713.1 DTW 20..209 CDD:281875 84/190 (44%)
Dtwd2NP_001101901.1 DTW 66..256 CDD:281875 84/190 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337148
Domainoid 1 1.000 158 1.000 Domainoid score I4054
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H79701
Inparanoid 1 1.050 191 1.000 Inparanoid score I3778
OMA 1 1.010 - - QHG58133
OrthoDB 1 1.010 - - D429011at33208
OrthoFinder 1 1.000 - - FOG0005667
OrthoInspector 1 1.000 - - oto97792
orthoMCL 1 0.900 - - OOG6_105506
Panther 1 1.100 - - LDO PTHR21392
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6102
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.