DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10050 and DTWD2

DIOPT Version :9

Sequence 1:NP_649713.1 Gene:CG10050 / 40873 FlyBaseID:FBgn0037492 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011541640.3 Gene:DTWD2 / 285605 HGNCID:19334 Length:318 Species:Homo sapiens


Alignment Length:269 Identity:110/269 - (40%)
Similarity:146/269 - (54%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDDAWLDLVGISADPPNRRNKCEKCKRPVVVCWCPALPHPPEAVSSQIVILQHPAEEKRSLRTAL 66
            :||:...|..:..:|..||.:|.:|.||..||.||.||..|..:|:.:.|:||||||.:.|||..
Human    48 DDDSADGLWELPVEPAERRPECTRCSRPQKVCLCPFLPAHPLHISTHLYIIQHPAEENKVLRTVP 112

  Fly    67 MLQLGLEPGKCVVYKGKRFPNHRNHADLQRILDSPQTLLLYPSRDSVPLEE--VDHSAGPYTLVL 129
            :|...|...||.|..|:||...|: .:|..:.....||:|||..::..|||  :|....|.|:::
Human   113 LLAACLPQDKCKVKIGRRFSEERD-PELSTVCRKSGTLILYPGAEAANLEEFILDSPVYPSTIII 176

  Fly   130 IDGTWPQAKAIY------------------ASSPALHR--LRQVKLIAVGISDYIIRTQPTEGCL 174
            |||||.|||.|:                  |...||.|  ..||:|.....|.|:||.|||..||
Human   177 IDGTWSQAKDIFYKNSLFRHPKQQEDFHLQARKRALTRTVTMQVQLKTSISSQYVIRMQPTNRCL 241

  Fly   175 STLETAAQCLAVLESRPELRQTLVRPLHTLCKYQLDNGAVEHQSKEFLLKNNQYPKPIGK----- 234
            ||||.||..|::||....:::||:|||..||.:||.:||....|||.||||..||||:.|     
Human   242 STLECAAVALSILEKNNYIQETLLRPLQALCSFQLQHGAQIRLSKEHLLKNGLYPKPMPKNKRKL 306

  Fly   235 RLSRLLRNT 243
            |...||.|:
Human   307 RKMELLMNS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10050NP_649713.1 DTW 20..209 CDD:281875 85/210 (40%)
DTWD2XP_011541640.3 DTW 66..276 CDD:309167 85/210 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143396
Domainoid 1 1.000 154 1.000 Domainoid score I4267
eggNOG 1 0.900 - - E1_COG3148
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H79701
Inparanoid 1 1.050 189 1.000 Inparanoid score I3913
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58133
OrthoDB 1 1.010 - - D429011at33208
OrthoFinder 1 1.000 - - FOG0005667
OrthoInspector 1 1.000 - - oto90685
orthoMCL 1 0.900 - - OOG6_105506
Panther 1 1.100 - - LDO PTHR21392
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10123
SonicParanoid 1 1.000 - - X6102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.