DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and AT2G32850

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_850199.1 Gene:AT2G32850 / 817846 AraportID:AT2G32850 Length:670 Species:Arabidopsis thaliana


Alignment Length:319 Identity:96/319 - (30%)
Similarity:155/319 - (48%) Gaps:60/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LNINGSRYTIRERLATGGFSLIDLGENAS-TRRSYAIKRITCHSIDDQNIALREIENCRKIDSEN 86
            |.|...:..:|..:|.||||.:.|.::.: ..:.||:|.:.|:..:...:.::||         :
plant    20 LEIGNLKVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHMICNDEESLELVMKEI---------S 75

  Fly    87 VIRVVDYELKGQADIVINTTSTLFIVLPYYKHG--------------------SLADHLQLRSRK 131
            |::    .|||..::|     ||      |.||                    ||.|.|:  :|.
plant    76 VLK----SLKGHPNVV-----TL------YAHGILDMGRNKKEALLAMDFCGKSLVDVLE--NRG 123

  Fly   132 QDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIV 196
            ..:..|.|.|.||..||..:.|:|...| .:||||||..|:.||...:..:.|.||:: ...:|.
plant   124 AGYFEEKQALTIFRDVCNAVFAMHCQSP-RIAHRDLKAENLLLSSDGQWKLCDFGSVS-TNHKIF 186

  Fly   197 GQTDAQRL-QDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERG 260
            .:.:...: :|...:.::..|||||::.:.....|.|:.|||:|||:|:.:|||.:.:|     |
plant   187 ERAEEMGIEEDNIRKYTTPTYRAPEMWDLFRREMISEKVDIWALGCLLFRICYFKNAFD-----G 246

  Fly   261 DSVALAVLSGNINIPEDSIYTEDMHELIKYMLRTDPMERPFV----FSVIERTHDLIQK 315
            :| .|.:|:||..|||...|:..:.:|||.||:..|.|||.:    |.|.|:....:||
plant   247 ES-KLQILNGNYRIPESPKYSVFITDLIKEMLQASPDERPDITQIWFRVNEQLPANLQK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 92/310 (30%)
S_TKc 30..300 CDD:214567 87/291 (30%)
AT2G32850NP_850199.1 STKc_GAK_like 26..299 CDD:270887 92/306 (30%)
Macoilin <261..>559 CDD:370635 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D831026at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.