DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and stk16

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001017630.1 Gene:stk16 / 550323 ZFINID:ZDB-GENE-050417-102 Length:306 Species:Danio rerio


Alignment Length:308 Identity:127/308 - (41%)
Similarity:183/308 - (59%) Gaps:21/308 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIEN 78
            |:  |.:..:.|:..||...::|..||||.:||.|.|...|.||:|||.||..:.:..|..|:|.
Zfish     6 CI--CSRSAITIDNKRYYFLQKLEEGGFSYVDLVEGAHDGRFYALKRILCHDREARKEAQTEVEM 68

  Fly    79 CRKIDSENVIRVVDY---ELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQI 140
            .|..:..||:.:..|   |..|:.:        .:::|||...||:...|:....|...|||::|
Zfish    69 HRLFNHPNVLSLTAYTFMERSGKCE--------AWLLLPYISKGSVWSVLEKLRDKGSFMPESRI 125

  Fly   141 LQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQ 205
            |.|..|:||||||||:.   ..||||||..|:.|.::..|.::|||||.:||:::.|..:|..:|
Zfish   126 LHILHGICEGLKAIHDK---GYAHRDLKPTNVLLDENDRPFLMDLGSMNKARIEVRGSREAMTVQ 187

  Fly   206 DEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSG 270
            |.|.:|.:|.|||||||.|:::|.|||||||||||||||.|.....|||.|:::|||||||| ..
Zfish   188 DWAAQRCTISYRAPELFNVESHCIIDERTDIWSLGCVLYCMMMLEGPYDLIFQKGDSVALAV-QN 251

  Fly   271 NINIPEDSIYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQKLEG 318
            .::||:...|:.::..|:...:.|:|.|||.:..|:    |.|:.|.|
Zfish   252 PVSIPQPCSYSPELQTLLSSTMVTNPQERPRIGWVL----DQIKSLRG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 121/287 (42%)
S_TKc 30..300 CDD:214567 116/272 (43%)
stk16NP_001017630.1 STKc_16 19..293 CDD:270888 122/289 (42%)
S_TKc 20..281 CDD:214567 116/272 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574808
Domainoid 1 1.000 217 1.000 Domainoid score I2629
eggNOG 1 0.900 - - E1_KOG2345
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2739
Inparanoid 1 1.050 228 1.000 Inparanoid score I3447
OMA 1 1.010 - - QHG53761
OrthoDB 1 1.010 - - D442669at33208
OrthoFinder 1 1.000 - - FOG0005637
OrthoInspector 1 1.000 - - oto38618
orthoMCL 1 0.900 - - OOG6_104003
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R967
SonicParanoid 1 1.000 - - X4038
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.