DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and stk16

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001004792.1 Gene:stk16 / 448012 XenbaseID:XB-GENE-971765 Length:305 Species:Xenopus tropicalis


Alignment Length:312 Identity:121/312 - (38%)
Similarity:182/312 - (58%) Gaps:19/312 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIE 77
            |.|..|.:.::.|...||....:|..||||.:||.|.....|.||:|||.||..:|:..|..|:|
 Frog     3 GALCICSRGSITIENKRYFFVHKLGEGGFSYVDLVEGVQDGRFYALKRILCHDREDRKEAQHEVE 67

  Fly    78 NCRKIDSENVIRVVDYEL-----KGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPE 137
            ..|..:..||:.:|.:.:     |.:|          :::||:.|.|:|.:.:::...:...:.|
 Frog    68 MHRLFNHPNVLPLVAHSIIEKGPKWEA----------WLLLPFVKGGTLWNQVEVLRDRNSFLSE 122

  Fly   138 AQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQ 202
            .:|:.|..|:|.||||||:.   ..||||||..|:.|.|...|:::|||||.:||:::.....|.
 Frog   123 DRIVHILHGICLGLKAIHDR---GYAHRDLKPTNVLLEDDDRPLLMDLGSMNQARMEVKDSRQAM 184

  Fly   203 RLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAV 267
            .:||.|.:|.:|.|||||||.|.:.|.||||||||||||||::|.:...|||.|:::||||||||
 Frog   185 AVQDWAAQRCTISYRAPELFNVSSDCVIDERTDIWSLGCVLFSMMFGEGPYDMIFQKGDSVALAV 249

  Fly   268 LSGNINIPEDSIYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQKLEGR 319
             ..||.:|.:..|::.:..|:..|:..:..||||:.::|.....|...:||:
 Frog   250 -QNNITVPANERYSQGLQTLLCSMMVVNSQERPFISTIISHVEALQPIVEGQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 115/289 (40%)
S_TKc 30..300 CDD:214567 109/274 (40%)
stk16NP_001004792.1 STKc_16 19..295 CDD:270888 115/289 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 209 1.000 Domainoid score I2788
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2739
Inparanoid 1 1.050 224 1.000 Inparanoid score I3424
OMA 1 1.010 - - QHG53761
OrthoDB 1 1.010 - - D442669at33208
OrthoFinder 1 1.000 - - FOG0005637
OrthoInspector 1 1.000 - - oto103194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R967
SonicParanoid 1 1.000 - - X4038
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.