DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10053 and SPAC6F6.19

DIOPT Version :9

Sequence 1:NP_001287206.1 Gene:CG10053 / 40871 FlyBaseID:FBgn0037490 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_001343075.1 Gene:SPAC6F6.19 / 9407200 PomBaseID:SPAC6F6.19 Length:122 Species:Schizosaccharomyces pombe


Alignment Length:139 Identity:43/139 - (30%)
Similarity:66/139 - (47%) Gaps:30/139 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LRRAHLLNKAGIKSDEEVSTEAYRRRATHKAEERKLQYDIKRCQ-QTCESLDLKSAITEPDLDFF 192
            |:|||...| ||..:|:::.       ..|.:::||...|.... :..:.:||:|||.|      
pombe    12 LQRAHPFYK-GIMLEEKLAD-------LEKMKQKKLFSRISLSNAKASQEIDLESAIKE------ 62

  Fly   193 WPPKPKDEDESQSDADDPEVEVPPKQEPYSPSEQLELLTGYLRTAYCFCYWCGTHYDDAEDLGSN 257
                     |:.|||...|.      |....|:||:::...||..:.:|.:||.|||..|||..|
pombe    63 ---------EANSDALYVEF------ESLEESKQLDVVLHLLRDRFLYCLYCGCHYDSQEDLIEN 112

  Fly   258 CPGLTRDEH 266
            |||:..::|
pombe   113 CPGINEEDH 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10053NP_001287206.1 G-patch 73..116 CDD:279867
DUF4187 219..266 CDD:290533 19/46 (41%)
SPAC6F6.19NP_001343075.1 DUF4187 72..121 CDD:316348 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3335
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2022
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003015
OrthoInspector 1 1.000 - - oto101153
orthoMCL 1 0.900 - - OOG6_105065
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1808
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.