DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10053 and SPAC1486.03c

DIOPT Version :9

Sequence 1:NP_001287206.1 Gene:CG10053 / 40871 FlyBaseID:FBgn0037490 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_594091.1 Gene:SPAC1486.03c / 2542910 PomBaseID:SPAC1486.03c Length:797 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:53/204 - (25%)
Similarity:83/204 - (40%) Gaps:58/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDEEEDYMSDKFLV---------GLQDVRPSL----------VHNRG------RKRQIEVESKK 40
            |:...||...|..|.         |.|..|..|          .||.|      |::.|....|.
pombe     8 MNSSSEDSDGDSILEEGRLRPSFRGQQKERDMLGIFGEEDEDGFHNSGIGSARLRRKNISFVEKS 72

  Fly    41 DELKKRQRETAASSGNVDNV--------RLQQSLNKP-ISADNKGF--QLLAKMGYKAGSGLGIT 94
            :::|..::.||.......::        .:.|:.|.| :..:..||  ::|.|||||.|.|||..
pombe    73 EQVKANKQVTADDLLEAHSIPQLKNKNDEVSQAKNIPKMKFNTTGFGAKMLEKMGYKQGQGLGAN 137

  Fly    95 SDARTEPVGITIKSGRGGLG---------REAAVA--ELA--------LKRQKLRRAHLLNKAGI 140
            ::...|||...::..|.|||         |:.|:|  |::        :|::.||..   .|..:
pombe   138 AEGIAEPVQSKLRPERVGLGAVRERTEKQRKEAIARGEISDSEDEKHTVKQKPLREK---KKKPL 199

  Fly   141 KSDEEVSTE 149
            ||.||:|.:
pombe   200 KSSEEISKD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10053NP_001287206.1 G-patch 73..116 CDD:279867 19/53 (36%)
DUF4187 219..266 CDD:290533
SPAC1486.03cNP_594091.1 TIP_N 22..85 CDD:289242 13/62 (21%)
G-patch 115..158 CDD:279867 18/42 (43%)
GCFC 334..622 CDD:285127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.