DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14607 and ckd

DIOPT Version :10

Sequence 1:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_647796.2 Gene:ckd / 38402 FlyBaseID:FBgn0035427 Length:140 Species:Drosophila melanogaster


Alignment Length:73 Identity:28/73 - (38%)
Similarity:42/73 - (57%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 NFDCAQQPLPGYYADIEAQCQVFHIC--ALNRTYSFLCPNGTVFSQETLVCVWWNQYDCVSAPSL 249
            :|||.::.: |:|||:|..||:||:|  ..|| ...||.|.|.|:||..:|.|...::|..:|..
  Fly    58 SFDCKRRSV-GFYADMEYNCQIFHMCDEEGNR-IPHLCANETSFNQEYRICDWDYNFNCTESPKW 120

  Fly   250 YANNAYIY 257
            :..|...|
  Fly   121 FYLNELTY 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14607NP_649709.2 PRK04654 <40..137 CDD:135173
CBM_14 190..243 CDD:426342 22/54 (41%)
ckdNP_647796.2 CBM_14 61..111 CDD:426342 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.