DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG14301

DIOPT Version :9

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster


Alignment Length:177 Identity:64/177 - (36%)
Similarity:94/177 - (53%) Gaps:16/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IVLVILGYTSAESKYRTPARILAKQTGATQ---FEEERYEAHTNCNEHKHHLKKRASDED----- 82
            :.::|.||......:.|.....||:..|.:   ||.|..:...| :|:....|......|     
  Fly     8 VFIIICGYLLYTDCHETVRSKRAKRPRAPEPVNFEPEPQQDLEN-DENGSQEKDLPEIPDNFLSP 71

  Fly    83 --VDY-EVYQGVVGRPGIDFPIYPRIPKTSFSC--RSYGNGYFADMETDCQVFHICE-EGRKISF 141
              .:| |:.:.:.||||:|:||...:|.|:|.|  :.| .|:||||||.||.:|.|: :||:.:|
  Fly    72 SVREYLELGKSIPGRPGVDYPILSAVPYTNFYCDEQEY-PGFFADMETRCQGWHYCDIDGRQATF 135

  Fly   142 LCPNGTIFQQSELTCDWWFKVNCLGSSGYYAESAEILNKQRVHRVRP 188
            ||||||.|.|:...|||||.|.|..|...||.:|.:..:.:|:..||
  Fly   136 LCPNGTQFSQAVFVCDWWFNVRCDLSPRLYAINARLYQRPKVNPTRP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 30/54 (56%)
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.