DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG14304

DIOPT Version :9

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_001138080.1 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:375 Identity:105/375 - (28%)
Similarity:156/375 - (41%) Gaps:84/375 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ESKYRTPARIL--AKQTGATQFEEERYEAHTNCNEHKHHLKKRASDEDVDYEV------------ 87
            ::..:|..|||  .|||....           .|..:||.:.::|.:|.||..            
  Fly   774 DNSIKTLIRILQNLKQTQTIV-----------ANPPQHHDEHKSSAQDYDYNTGSEEEHHSQSEE 827

  Fly    88 ----------YQG-VVGRPGIDFPIYPRIPKTSFSC-RSYGNGYFADMETDCQVFHICE-EGRKI 139
                      :.| ..||||||:|.|..||:|||.| :....|:|.|.||:|||:|.|: .|.|.
  Fly   828 AIARPKGPNKHPGPSTGRPGIDYPNYAEIPQTSFECTKQRYKGFFGDPETNCQVWHYCDLNGGKA 892

  Fly   140 SFLCPNGTIFQQSELTCDWWFKVNCLGSSGYYAESAEILNKQRVHRVRPSVP--VQGFN--IVGG 200
            ||||||||||.|..|||||||.|.|..::..|     :||::....:.|..|  .:.:|  ||..
  Fly   893 SFLCPNGTIFSQIALTCDWWFNVKCSTTAQLY-----VLNERLYKYILPFNPKFPEDYNGPIVDK 952

  Fly   201 GLNIK----PKVTPVAGQGRSAAPRANPDRRIDSTEDVPASVESVDFDDVSGEKQRKVLPSIDNN 261
            .|.:|    .:...:..|.::|.....|       |:.|:::.::       .|..|..|...:.
  Fly   953 YLAMKFQEMEEKMRLEKQRKAAQEAQKP-------EEAPSTLPAL-------PKNHKPEPKHGSG 1003

  Fly   262 SNDQESQITAESSSF-------VSGSGKRRTNKESNP--------NRNDDITVLKPARL-RTPVA 310
            .|.|..:.::|.:..       :|..|...|..::.|        .::....||||..: .||..
  Fly  1004 INAQVYEQSSEKNLLIDDEIDDISERGTYDTYDQTAPTTIMAPTSTQDTQSFVLKPIVVSSTPQP 1068

  Fly   311 TQERGVSTERARNGQRGQHRYSGSEEHSKERERPTPGQSK---EKPEFFE 357
            ..|.....|....|...:..:..|...:||.|:.|...:|   ||.|..|
  Fly  1069 LPEIDFEVEPTAPGSSEEEDHLQSLRETKEAEKKTRESTKVSVEKLEVIE 1118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 32/53 (60%)
CG14304NP_001138080.1 CBM_14 863..917 CDD:279884 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.