DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG14607

DIOPT Version :9

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:163 Identity:63/163 - (38%)
Similarity:82/163 - (50%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SDEDVDYEVYQGVVGRPGIDFPIYPRIPKTSFSCRSYG-NGYFADMETDCQVFHICEEGRKISFL 142
            :|.|.||....||   ||:|:|||.::|:|:|.|.... .||:||:|..|||||||...|..|||
  Fly   160 NDSDGDYSAIPGV---PGVDYPIYAQVPRTNFDCAQQPLPGYYADIEAQCQVFHICALNRTYSFL 221

  Fly   143 CPNGTIFQQSELTCDWWFKVNCLGSSGYYAESAEIL-------------NKQRVHR-VRPSVPVQ 193
            |||||:|.|..|.|.||.:.:|:.:...||.:|.|.             |...|:| ...|....
  Fly   222 CPNGTVFSQETLVCVWWNQYDCVSAPSLYANNAYIYDYSERSGSNLRTSNTNNVYRPAASSSAAF 286

  Fly   194 GFNIVGGGLNIKPKVTPVAG--QGRSAAPRANP 224
            |..:...|......|:.|||  .||.:.|.|.|
  Fly   287 GAPLATTGTLRATGVSQVAGYNSGRGSYPSATP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 28/52 (54%)
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.