DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG13675

DIOPT Version :9

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster


Alignment Length:375 Identity:90/375 - (24%)
Similarity:137/375 - (36%) Gaps:96/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AKQTGATQFEEERYEAHTNCNEHKHHLKKRASDEDVDYEVYQGVVGR----------PGIDFPIY 102
            |..|.|.:..:::.      :..:.||:..|....|.:.::..:.|.          .|.|:|.|
  Fly     3 ATTTAANKSPQQQQ------HRRQQHLQWSACIMIVVFGLFSMLAGNCVNGQIDGYTAGEDYPAY 61

  Fly   103 PRIPK-TSFSCRSYGNGYFADMETDCQVFHIC-EEGRKISFLCPNGTIFQQSELTCDWWFKVNCL 165
            ..:|| .:|:|:....||:||.||.|||:|.| ..|.:.||||||||:|.|:...||||..|||.
  Fly    62 DAVPKGLAFNCQGRQPGYYADTETRCQVWHWCLHSGHQYSFLCPNGTVFNQAVRVCDWWSNVNCE 126

  Fly   166 GSSGYYAESAEI---------LN------------------KQRVHRVRPSVPVQ---------- 193
            ||...|..:.|:         ||                  :||..|.|.....|          
  Fly   127 GSEQLYQNNDELYRIPERQQQLNDVXYEADDEYKIGTANGTRQRGGRQRQFQKQQQQKQQQQQHQ 191

  Fly   194 --GFNIVGGGLNIKPKVTPVA-----------GQGRSAAPRANPDRRIDSTEDVPASVESVDFDD 245
              ..|...||:|...::...:           |..|...|..||.....|::.          ..
  Fly   192 ALNSNTAIGGINSSNRIVDSSNYSKMTKNSFRGSMRFTTPSTNPQSSYSSSQQ----------QQ 246

  Fly   246 VSGEKQRKVLPSIDNNSNDQESQITAESSSFVSGSGKRRTNKESNPNRNDDITVLKPARLRTPVA 310
            ...::|:|......|:|.:.|                 |.:|.|:.|..|..:....:|.||. .
  Fly   247 QQQQQQQKQHQKQHNSSRNSE-----------------RKSKPSSVNHRDRDSNQTRSRNRTH-N 293

  Fly   311 TQERGVSTERARNGQRGQHRYSGSEEHSKERERPTPGQSKEKPEFFEAHS 360
            |.:.|.......|..||:.||:.::..:....:....:.|.|......||
  Fly   294 TPQSGKKNNSNNNSSRGKQRYNTNKFENDAELKDYKSKIKNKYNIDYDHS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 28/52 (54%)
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.