DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14606 and VBA1

DIOPT Version :9

Sequence 1:NP_001334690.1 Gene:CG14606 / 40866 FlyBaseID:FBgn0037485 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_013806.1 Gene:VBA1 / 855113 SGDID:S000004694 Length:562 Species:Saccharomyces cerevisiae


Alignment Length:422 Identity:77/422 - (18%)
Similarity:134/422 - (31%) Gaps:158/422 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TQASWVGSLIGLGSLTGNIIFGLLLDRLGRK----VCMYFLAIPNMIYWILIYSAQDVTYLYAGR 121
            ::..|:.:...|.:.....::|.|.|..|||    ...:|..:.    .:|...|::||.....|
Yeast    71 SKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLG----CLLTCFARNVTEFSIAR 131

  Fly   122 FLAGMSGGGCYVVLPIFIAEIADNSVRGALSSMAMMYVSIGMMVGFTLASYLPYYLMPCIIVALP 186
            .:.|:..||...:..|.:::|.....||.....|.:....|.::|..|                 
Yeast   132 AICGIGAGGLNAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPL----------------- 179

  Fly   187 VVFMLSVIGLSETPQYLLRRGRDDQAEKSFYFYKNLTPPTSSDKEASQHDAAKIEFDTFRLQVLS 251
                                                                             
Yeast   180 ----------------------------------------------------------------- 179

  Fly   252 GGV-TESISWRDFINVPTLKIFGL-IFVLIICNQLSGSFAIFNYTSHIFAELGNNLDPNTSTIVV 314
            ||| .|:|.||        .:||: :.|:::|:.|    ||.|....:|     ::.|......:
Yeast   180 GGVFIETIGWR--------ALFGIQVPVIMLCSVL----AIKNINIKLF-----HVPPMKERYTL 227

  Fly   315 GAAQLVGIFSAVVLVDRLGRRVLLLTSMGGMGLGELAIALLKCFASDEFLNQNGWLPLVIMCLVA 379
            .....:.||.::.||..:...:.|.:|.    |.:|.:||   |....|                
Yeast   228 KNLSRIDIFGSLSLVATISGVLFLCSSQ----LNKLYLAL---FTIGSF---------------- 269

  Fly   380 CIASLGVIALIFIII------IELLPAKI--RSIGTSLSMATFSGFIFVALKIYPTMIYDQGLAA 436
                     ::||::      .::||.::  ||...|.::...|.|: |..:|:.:.||.|.|..
Yeast   270 ---------IVFILVERYYATEKILPFELLTRSFCLSSAVTVISSFV-VFGEIFRSPIYLQLLQN 324

  Fly   437 TMFMSAGMCLF--------GFIVLGLFLPETK 460
            ......|:.|.        |.:|.|..|..||
Yeast   325 ISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14606NP_001334690.1 None
VBA1NP_013806.1 MFS_Azr1_MDR_like 42..469 CDD:341045 77/422 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.