DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14606 and STP11

DIOPT Version :9

Sequence 1:NP_001334690.1 Gene:CG14606 / 40866 FlyBaseID:FBgn0037485 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_197718.1 Gene:STP11 / 832391 AraportID:AT5G23270 Length:514 Species:Arabidopsis thaliana


Alignment Length:439 Identity:102/439 - (23%)
Similarity:177/439 - (40%) Gaps:92/439 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SLIGLGSLTGNIIFGLLLDRLGRKVCMYFLAIPNMIYWILIYSAQDVTYLYAGRFLAGMSGGGCY 132
            |.:.|.:|..:.:...:....||||.|...::..:...:|...|.::..|..||...|:..|...
plant    89 SSLYLAALFASFLASTITRLFGRKVSMVIGSLAFLSGALLNGLAINLEMLIIGRLFLGVGVGFAN 153

  Fly   133 VVLPIFIAEIADNSVRGALSSMAMMYVSIGMMVGFTLASYLPYYLMPCI-----------IVALP 186
            ..:|::::|:|...:||||:....:.::||:     ||:.:..|:.|.:           :..:|
plant   154 QSVPLYLSEMAPAKIRGALNIGFQLAITIGI-----LAANIVNYVTPKLQNGIGWRLSLGLAGVP 213

  Fly   187 VVFMLSVIG---LSETPQYLLRRGRDDQAEKSF----------YFYKNLTPPTSSDKEASQHDAA 238
            .|.||  :|   |.:||..:|.||..::|::..          :.:..|.....:.|:. :|...
plant   214 AVMML--VGCFFLPDTPNSILERGNKEKAKEMLQKIRGTMEVEHEFNELCNACEAAKKV-KHPWT 275

  Fly   239 KIEFDTFRLQVLSGGVTESISWRDFINVPTLKIFGLIFVLII--CNQLSGSFAIFNYTSHIFAEL 301
            .|....:|.|                         |.|...|  ..||:|...|..|...:|..:
plant   276 NIMQARYRPQ-------------------------LTFCTFIPFFQQLTGINVIMFYAPVLFKTI 315

  Fly   302 GNNLDPN-TSTIVVGAAQLVGIFSAVVLVDRLGRRVLLLTSMGGMGLGELAIALLKCFASDEFLN 365
            |...|.: .|.::.|...::....::..||:.|||.|.|.....|.:.::|:.           :
plant   316 GFGNDASLISAVITGLVNVLSTIVSIYSVDKFGRRALFLQGGFQMIVTQIAVG-----------S 369

  Fly   366 QNGW----------------LPLVIMCL-VACIA-SLGVIALIFIIIIELLPAKIRSIGTSLSMA 412
            ..||                :.|.::|| ||..| |.|.:.  :::..|:.|.:|||.|.||:::
plant   370 MIGWKFGFNGEGNLSGVDADIILALICLYVAGFAWSWGPLG--WLVPSEICPLEIRSAGQSLNVS 432

  Fly   413 TFSGFIFVALKIYPTMIYDQGLAATMFMSAGMCLFGFIVLGLFLPETKG 461
            ....|.|...:.:.||:.........|. |||.|...|.:...||||||
plant   433 VNMFFTFFIGQFFLTMLCHMKFGLFYFF-AGMVLIMTIFIYFLLPETKG 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14606NP_001334690.1 None
STP11NP_197718.1 Sugar_tr 28..490 CDD:278511 102/439 (23%)
MFS 79..474 CDD:119392 96/431 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.