DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14606 and Slc2a4

DIOPT Version :9

Sequence 1:NP_001334690.1 Gene:CG14606 / 40866 FlyBaseID:FBgn0037485 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_036883.1 Gene:Slc2a4 / 25139 RGDID:2711 Length:509 Species:Rattus norvegicus


Alignment Length:522 Identity:134/522 - (25%)
Similarity:211/522 - (40%) Gaps:127/522 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSQKLSVFSVRYRWQFIATMTVHIMTLTHGIAVGWLSPSLRLLASD--------ESPLGDPLTIT 61
            |.|:::...|      :|..:..:.:|..|..:|.::...:::...        :.| |.|.:|.
  Rat    16 PQQRVTGTLV------LAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNATWLGRQGP-GGPDSIP 73

  Fly    62 QAS----WVGS--LIGLGSLTGNIIFGLLLDRLGRKVCMY---FLAIPNMIYWILIYSAQDVTYL 117
            |.:    |..|  :..:|.:..:.:.|::...||||..|.   .||:.......|..:|.....|
  Rat    74 QGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLANNVLAVLGGALMGLANAAASYEIL 138

  Fly   118 YAGRFLAGMSGGGCYVVLPIFIAEIADNSVRGALSSMAMMYVSIGMMVGFTL--------ASYLP 174
            ..||||.|...|....::|:::.|||...:||||.::..:.:.||::|...|        |:..|
  Rat   139 ILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILVAQVLGLESMLGTATLWP 203

  Fly   175 YYLMPCIIVALPVVFMLSVIGL-SETPQYL-LRRGRDDQAEKSFYFYKNLTP-PTSSDKEASQHD 236
            ..|   .|..||.:..|.::.. .|:|:|| :.|..:..|.||.   |.||. ...||..|...|
  Rat   204 LLL---AITVLPALLQLLLLPFCPESPRYLYIIRNLEGPARKSL---KRLTGWADVSDALAELKD 262

  Fly   237 -AAKIEFDTFRLQVLSGGVTESISWRDFINVPTLKIFG---------LIFVLIICNQLSGSFAIF 291
             ..|:|    |.:.||                .|::.|         :..||.:..||||..|:|
  Rat   263 EKRKLE----RERPLS----------------LLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVF 307

  Fly   292 NYTSHIFAELGNNLDPNTSTIVVGAAQLVGIFSAVVLVDRLGRRVLLLTSMGGMG----LGELAI 352
            .|::.|| ||.....|..:||..|....|....:|:||:|.|||.|.|..:.||.    |..:|:
  Rat   308 YYSTSIF-ELAGVEQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVAL 371

  Fly   353 ALLKCFASDEFLNQNGWLPLVIMCLVACIASLGVIALI--------FIIIIELL-----PAKIRS 404
            .||:...|              |..|:.:|..|.:|..        :.|:.||.     ||.:..
  Rat   372 LLLERVPS--------------MSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAV 422

  Fly   405 IGTSLSMATF---SGFIFVALKIYPTMIYDQGLAATMFMSAGMCLFGFIVLGLFL------PETK 460
            .|.|.....|   .||.:||          ..:...:|:     ||..::||.|:      |||:
  Rat   423 AGFSNWTCNFIVGMGFQYVA----------DAMGPYVFL-----LFAVLLLGFFIFTFLRVPETR 472

  Fly   461 GK 462
            |:
  Rat   473 GR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14606NP_001334690.1 None
Slc2a4NP_036883.1 Interaction with SRFBP1. /evidence=ECO:0000250|UniProtKB:P14672 7..13
Sugar_tr 27..483 CDD:278511 131/505 (26%)
MFS 78..447 CDD:119392 112/419 (27%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 298..304 4/5 (80%)
Dileucine internalization motif. /evidence=ECO:0000255 489..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.