DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14606 and K09C4.2

DIOPT Version :9

Sequence 1:NP_001334690.1 Gene:CG14606 / 40866 FlyBaseID:FBgn0037485 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:100 Identity:24/100 - (24%)
Similarity:38/100 - (38%) Gaps:37/100 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 IASLGVIALIFIIIIELLPAKIRS-IGTSL---SMAT--------------FSGFIFVALKIYPT 427
            :.:.|..|:..:.:.||.|...|: :|.::   |||.              ||...||...|..|
 Worm     9 VPATGANAIRLLFVTELFPPSARTVVGQAMLFGSMAVGMPVVSLFPIINSIFSPIFFVPFVIVQT 73

  Fly   428 MIYDQGLAATMFMSAGMCLFGFIVLGLFLPETKGK 462
                              :|| |.|..::|||:|:
 Worm    74 ------------------VFG-IYLYRYMPETRGR 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14606NP_001334690.1 None
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.