DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14606 and srx-128

DIOPT Version :9

Sequence 1:NP_001334690.1 Gene:CG14606 / 40866 FlyBaseID:FBgn0037485 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_506426.3 Gene:srx-128 / 186283 WormBaseID:WBGene00006019 Length:339 Species:Caenorhabditis elegans


Alignment Length:149 Identity:37/149 - (24%)
Similarity:63/149 - (42%) Gaps:39/149 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SLTGNI--IFGLLLD---RLGR-----KVCMYFLAIPNMI------YWIL-----IYSAQDVTYL 117
            ||.|:|  |: |||.   |.||     |:|: ...:||:|      :|::     .||..:|.| 
 Worm    50 SLLGSICNIY-LLLKFSARDGRPNGFQKICL-VKTVPNIIVCLSFLFWVVPLTAFSYSYNEVNY- 111

  Fly   118 YAGRFLAGMSGGGCYVVLPIFIAEIADNSVRGALSSMAMMYVSIGMMVGFTLASYLPYYLMPCII 182
            :....:.|::|...|::.||....::.|          ..|| :....|..|...:|...:...|
 Worm   112 WLNSLVGGVAGTWAYLLTPILQVSMSCN----------RFYV-LYFPFGIKLVKKVPMTNVIITI 165

  Fly   183 VALPVVFMLSVIGLSETPQ 201
            .:|.|    |::..:..|:
 Worm   166 ASLSV----SIVAATTLPK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14606NP_001334690.1 None
srx-128NP_506426.3 7TM_GPCR_Srx 47..307 CDD:370981 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.