DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14606 and SLC2A13

DIOPT Version :9

Sequence 1:NP_001334690.1 Gene:CG14606 / 40866 FlyBaseID:FBgn0037485 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_443117.3 Gene:SLC2A13 / 114134 HGNCID:15956 Length:648 Species:Homo sapiens


Alignment Length:541 Identity:108/541 - (19%)
Similarity:197/541 - (36%) Gaps:148/541 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GIAVGWLSPSLRLLASDESPLGDPLTITQASW----VGSLIG---LGSLTGNIIFGLLLDRLGRK 91
            |...|.:|.::.||....|        ..|.|    |.|.:|   :.:|.|..:.|:    .||:
Human    96 GYDTGVVSGAMLLLKRQLS--------LDALWQELLVSSTVGAAAVSALAGGALNGV----FGRR 148

  Fly    92 VCMYFLAIPNMIYWILIYSAQDVTYLYAGRFLAGMSGGGCYVVLPIFIAEIADNSVRGALSSMAM 156
            ..:...:........::.:|.:...|.|||.:.|:..|...:.:|::|||::..::||.|.::..
Human   149 AAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVTINT 213

  Fly   157 MYVSIGMMVGFTLASYLPY-------YLMPCIIVALP-VVFMLSVIGLSETPQYLLRRGRDDQAE 213
            ::::.|......:.....|       |::.  :.|:| |:.....:.|.|:|::|:::|   |.:
Human   214 LFITGGQFFASVVDGAFSYLQKDGWRYMLG--LAAVPAVIQFFGFLFLPESPRWLIQKG---QTQ 273

  Fly   214 KSFYFYKNLTPPTSSDKEASQHDAAKIEFDTFRLQVLSGG--VTESISWRDFINVPTLKIFGLIF 276
            |:......:....:.|:|   :|:.|...:....:|.|.|  :...:|:     .||.:...:..
Human   274 KARRILSQMRGNQTIDEE---YDSIKNNIEEEEKEVGSAGPVICRMLSY-----PPTRRALIVGC 330

  Fly   277 VLIICNQLSGSFAIFNYTSHIFAELGNNLDPNTSTIVVGAA--------QLVGIFSAVVLVDRLG 333
            .|.:..||||...|..|::.|....|  ::.:...|.:.:.        .|||::    ||:::|
Human   331 GLQMFQQLSGINTIMYYSATILQMSG--VEDDRLAIWLASVTAFTNFIFTLVGVW----LVEKVG 389

  Fly   334 RRVLLLTSMGGMGLGELAIAL-------------------------------------------- 354
            ||.|...|:.|..:..:.:||                                            
Human   390 RRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNECMLDPDCGFC 454

  Fly   355 --------------------------------LKCFASDEFLNQN------GWLPLVIMCLVACI 381
                                            .|....|.|...|      .|..|:.:.|....
Human   455 YKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDIFWAYNFCPTPYSWTALLGLILYLVF 519

  Fly   382 ASLGVIALIFIIIIELLPAKIRSIGTSLSMATFSGF-----IFVALKIYPTMIYDQGLAATMFMS 441
            .:.|:..:.:.:..|:.|...||.|.:.|    ||.     :.|:|....|..|.....| .|:.
Human   520 FAPGMGPMPWTVNSEIYPLWARSTGNACS----SGINWIFNVLVSLTFLHTAEYLTYYGA-FFLY 579

  Fly   442 AGMCLFGFIVLGLFLPETKGK 462
            ||....|.:.:...|||||||
Human   580 AGFAAVGLLFIYGCLPETKGK 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14606NP_001334690.1 None
SLC2A13NP_443117.3 Sugar_tr 84..609 CDD:278511 108/541 (20%)
MFS 86..591 CDD:119392 101/530 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.