DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lap and AT1G25240

DIOPT Version :9

Sequence 1:NP_001163538.1 Gene:lap / 40863 FlyBaseID:FBgn0086372 Length:788 Species:Drosophila melanogaster
Sequence 2:NP_001323408.1 Gene:AT1G25240 / 839107 AraportID:AT1G25240 Length:377 Species:Arabidopsis thaliana


Alignment Length:280 Identity:60/280 - (21%)
Similarity:115/280 - (41%) Gaps:42/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LVHCTNEPNVSIP-HLANLLIE--RSQNAN-----------------WVVVYKSLITTHHLMAYG 91
            ::|.|:..:.|:. |.|:.:.:  ||..||                 |:|..|:|:..|.::.. 
plant    38 IIHATSHDDSSVDYHNAHRVYKWIRSSPANLKPLVHALSSRVNRTRSWIVALKALMLVHGVLCC- 101

  Fly    92 NERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSYRAMAF 156
              :...........|:||.|.|       |...|....|:  :.|||.|..:|::.|.      |
plant   102 --KVTSLQEIRRLPFDLSDFSD-------GHSRPSKTWGF--NAFIRAYFSFLDQYSF------F 149

  Fly   157 DFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRL 221
            ...:::|..::..|.|:|.|  |:.:..||:.|..||:....::::...:|..:...:..::..:
plant   150 LSDQIRRRHKKPQLDSVNQE--LERIEKLQSLLHMLLQIRPMADNMKKTLILEAMDCVVIEIFDI 212

  Fly   222 FACYNDGIINLLEKYFD-MNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGIDKG-DIPDLTKA 284
            :......|..||.|... ..|..|..||.:.||...:.:.:..:.:..:..|:... |||.....
plant   213 YGRICSAIAKLLIKIHPAAGKAEAVIALKIVKKATSQGEDLALYFEFCKEFGVSNAHDIPKFVTI 277

  Fly   285 PSSLLDALEQHLATLEGRKV 304
            |...:.|:|:.:..:|..:|
plant   278 PEEDIKAIEKVINGVEEEEV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lapNP_001163538.1 ANTH 21..298 CDD:284961 58/272 (21%)
Amelogenin 694..>773 CDD:197891
AT1G25240NP_001323408.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22951
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.