DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lap and AT1G14686

DIOPT Version :9

Sequence 1:NP_001163538.1 Gene:lap / 40863 FlyBaseID:FBgn0086372 Length:788 Species:Drosophila melanogaster
Sequence 2:NP_683306.1 Gene:AT1G14686 / 838032 AraportID:AT1G14686 Length:339 Species:Arabidopsis thaliana


Alignment Length:325 Identity:63/325 - (19%)
Similarity:137/325 - (42%) Gaps:57/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LAKSVCKATTEECIGPKKKHLDYLV-HCTNEPNVSIPHLANLLIER-SQNANWVVVYKSLITTHH 86
            |..:|.|||:.:.:....:...::. |..:.|: |:..|.:|:..| .:..:|.|..|.|:..|.
plant    24 LTAAVVKATSHDELSIDTESAQFIYRHVLSSPS-SLKPLVSLISSRVKRTRSWAVALKGLMLMHG 87

  Fly    87 LMAYGNERFMQYLASSNST-------FNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYL 144
            .          :|..|...       |:||||      .:|...:.....|:::  |:|.|..:|
plant    88 F----------FLCKSTVAESIGRLPFDLSSF------GEGNSRIMSKSGGFNL--FVRAYFAFL 134

  Fly   145 NEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEK--LLKTLPVLQAQL--DALLEFDCQSNDLSNG 205
            :.:|:.:              .:|:....|.|.  |::.:.:.:.|:  |:|:.......::...
plant   135 DRRSILF--------------HDGNRHRYNEESSVLIRLVIIRKMQIIVDSLIRIKPIGENMMIP 185

  Fly   206 VINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVR-MDRVGEFLKVAE 269
            |||.:...:..:::.::......|..:|.   :::.|..:...||..|.:.: |.:.||..|..|
plant   186 VINEAMENVVSEIMEIYGWICRRIAEVLP---NVHSKIGKTEADLALKIVAKSMKQGGELKKYFE 247

  Fly   270 ---NVGIDKG-DIPDLTKAPSSLLDALEQHLAT-LEGRKVSAANT--PTQSSSNQRNVKSAVSAL 327
               ::|:... :||:..:.|.:.:..|::.:.| :|..:.||..|  ..:....:..:::.:|.|
plant   248 FCKDLGVSNAQEIPNFVRIPEADVIHLDELVRTAMESSEESAERTEIAEEEEEEEEEIETKLSDL 312

  Fly   328  327
            plant   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lapNP_001163538.1 ANTH 21..298 CDD:284961 56/291 (19%)
Amelogenin 694..>773 CDD:197891
AT1G14686NP_683306.1 VHS_ENTH_ANTH 24..276 CDD:413366 56/287 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22951
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.