DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lap and AT4G40080

DIOPT Version :9

Sequence 1:NP_001163538.1 Gene:lap / 40863 FlyBaseID:FBgn0086372 Length:788 Species:Drosophila melanogaster
Sequence 2:NP_195718.1 Gene:AT4G40080 / 830171 AraportID:AT4G40080 Length:365 Species:Arabidopsis thaliana


Alignment Length:187 Identity:44/187 - (23%)
Similarity:78/187 - (41%) Gaps:26/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SVCKATTEE-CIGPKKKHLDYLVHCTNEPNVSIPHLANLLIER-SQNANWVVVYKSLITTHHLMA 89
            ||.:|||.: ...|..:||..::........:.......::|| ....:..|..||||..||::.
plant    40 SVLRATTHDPSTPPGNRHLAVILSAGTGSRATASSAVESIMERLHTTGDACVALKSLIIIHHIVK 104

  Fly    90 YG----NERFMQYLASSNSTF-NLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSL 149
            :|    .::...:.||....: .||:|.|:.:           .:.:::|.::|.||.||.....
plant   105 HGRFILQDQLSVFPASGGRNYLKLSAFRDEKS-----------PLMWELSSWVRWYALYLEHLLS 158

  Fly   150 SYRAMAFDFCK----VKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDL 202
            :.|.|.|....    :.:.:.|..:.|:....||:.:..|.    .|||..|:..||
plant   159 TSRIMGFFISSTSSTIHKEEYEEMVSSLTNSDLLREIDALV----GLLEEACKIPDL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lapNP_001163538.1 ANTH 21..298 CDD:284961 44/187 (24%)
Amelogenin 694..>773 CDD:197891
AT4G40080NP_195718.1 ANTH_N_AP180_plant 37..160 CDD:340784 30/130 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22951
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.