DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lap and AT2G01920

DIOPT Version :9

Sequence 1:NP_001163538.1 Gene:lap / 40863 FlyBaseID:FBgn0086372 Length:788 Species:Drosophila melanogaster
Sequence 2:NP_178301.1 Gene:AT2G01920 / 814723 AraportID:AT2G01920 Length:312 Species:Arabidopsis thaliana


Alignment Length:323 Identity:70/323 - (21%)
Similarity:130/323 - (40%) Gaps:56/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SVCKATTEECIGPKKKHLDYLV-HCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAY 90
            :|.|||:...:....:::.::. :..:.|:...|.:..:.:......||.|..|.|:..|.|...
plant    32 AVIKATSHNDVSMDIENVQFIYRYIQSNPSSFKPIIRAVSLRVEHTRNWTVALKCLMLLHGLFFS 96

  Fly    91 GNERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSY--RA 153
            |   .|...:.....|:||.|        |.......|.| ..:.|:|.|..:|:|:|:.|  :.
plant    97 G---IMTVDSIGRLPFDLSGF--------GRRKSRFSRTG-RFNIFVRAYFMFLDERSILYYNKN 149

  Fly   154 MAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDL 218
            |......||..:...||  |..:.:.:|..|::|     :|:......|.||.|...|.....|:
plant   150 MIRLEIIVKMQRIVDSL--MRIKPIGETPLVIEA-----MEYVISEVVLINGHICRGFAGFLSDV 207

  Fly   219 IRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGI----DKGDIP 279
            ..          |:||    ::...|..|:::..|.|.:.:::.::.:.....|:    :..:|.
plant   208 QS----------NMLE----ISSAEADLAMNIVAKSLSQREKLFKYFEFCRGFGVTNAQETSNIL 258

  Fly   280 DLTKAPSSLLDALEQHLA------TLEGRKVSAANTPTQSSSNQRNVKSAVSALSSTSSAFGT 336
            .:|::...:||.| .|:|      ..:...|:||:.....:|.:|         |:|.|.|.|
plant   259 RITESQMIVLDKL-LHIAPELDWKAAKVTPVTAADMVDLVTSEER---------SNTPSDFLT 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lapNP_001163538.1 ANTH 21..298 CDD:284961 60/283 (21%)
Amelogenin 694..>773 CDD:197891
AT2G01920NP_178301.1 VHS_ENTH_ANTH 29..275 CDD:295355 59/276 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22951
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.