DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lap and picalml

DIOPT Version :9

Sequence 1:NP_001163538.1 Gene:lap / 40863 FlyBaseID:FBgn0086372 Length:788 Species:Drosophila melanogaster
Sequence 2:NP_001121417.1 Gene:picalml / 100158505 XenbaseID:XB-GENE-955041 Length:226 Species:Xenopus tropicalis


Alignment Length:233 Identity:147/233 - (63%)
Similarity:184/233 - (78%) Gaps:12/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MAGQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIE 67
            |:||:|.||:.||:||:.|..:||:||||||.|.:||||||||||:.||||.||:||.||:.|.|
 Frog     1 MSGQSITDRITAAQHSVTGSAVAKAVCKATTHEMMGPKKKHLDYLIQCTNEMNVNIPQLADTLFE 65

  Fly    68 RSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYD 132
            |:.|.:||||:|:||||||||.||||||:|||||.|:..||::|||:|.:|           |||
 Frog    66 RTANGSWVVVFKALITTHHLMMYGNERFIQYLASRNTLLNLNNFLDRGAMQ-----------GYD 119

  Fly   133 MSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDC 197
            ||.|||||::|||||:||||.:|.||.|:||| .:|.:|:|..||||||||::|.||||||.||.
 Frog   120 MSTFIRRYSRYLNEKALSYRLVAVDFTKMKRG-VDGVMRTMVTEKLLKTLPIIQNQLDALLNFDA 183

  Fly   198 QSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEK 235
            .:|:|:||||...|||||:|.|||||.||:|:||||.|
 Frog   184 NTNELTNGVIKTGFMLLFKDSIRLFAAYNEGVINLLAK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lapNP_001163538.1 ANTH 21..298 CDD:284961 137/215 (64%)
Amelogenin 694..>773 CDD:197891
picalmlNP_001121417.1 ANTH_N_AP180 22..138 CDD:340782 81/126 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.