DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and CCN4

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_003873.1 Gene:CCN4 / 8840 HGNCID:12769 Length:367 Species:Homo sapiens


Alignment Length:360 Identity:85/360 - (23%)
Similarity:113/360 - (31%) Gaps:116/360 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 TVVATEGAAPSTNGTGESAVTL---PTTDDEATPKPRTDCHYNSGVYKFRERLEIGCEQICHCAE 671
            |:.|...||.||    ..|..|   |||.| .||.|..|   .|...:|       |:..|.|..
Human     8 TLAAVTAAAAST----VLATALSPAPTTMD-FTPAPLED---TSSRPQF-------CKWPCECPP 57

  Fly   672 GGVMDCRPRCPERNHTRLDKCVYVKDPKDVCCQLELCDVTLDDHEQQPTPLQSNNNEDPEEIDPF 736
            .     .||||.......|.|        .||  ::|...|.|           |..:....||.
Human    58 S-----PPRCPLGVSLITDGC--------ECC--KMCAQQLGD-----------NCTEAAICDPH 96

  Fly   737 RFQEQARDAGGAKPT-------------CTFKGAEYDVGQQFRDGCDQLCICNEQGIHCAKLECP 788
            |  ....|..|.:|.             |...|..|:.||.|:..|...|.|.:..:.|..| | 
Human    97 R--GLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPL-C- 157

  Fly   789 SNFGLDVQDPHCIRWEPVPADFKPSPPNCCPESMRCVDNG----------TCSYQGV-QIE---- 838
                |.|:.|..  |.|.|.  :.|.|..|.|...|.|:.          |.::..| ::|    
Human   158 ----LRVRPPRL--WCPHPR--RVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHR 214

  Fly   839 -------NWSP--------VPANLTGCDQHCYCENGRVECRAACPPVPALPPADLPCHPAL---A 885
                   .|||        |...::..:..|:.|.....|.        |.|.|:..|..:   .
Human   215 NCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCN--------LRPCDVDIHTLIKAGK 271

  Fly   886 RLLPIPDDECCKHWMCAPQI------PKIGGAGQD 914
            :.|.:...|...::..|..|      ||..|...|
Human   272 KCLAVYQPEASMNFTLAGCISTRSYQPKYCGVCMD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 22/71 (31%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
CCN4NP_003873.1 IGFBP 49..101 CDD:365955 18/79 (23%)
VWC 123..181 CDD:214564 21/67 (31%)
TSP1 220..260 CDD:214559 9/47 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.