DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and CCN5

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001310299.1 Gene:CCN5 / 8839 HGNCID:12770 Length:250 Species:Homo sapiens


Alignment Length:335 Identity:69/335 - (20%)
Similarity:97/335 - (28%) Gaps:137/335 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   654 KFRERLEIGCEQICHCAEGGVMDCRPRCPERNHTRLDKCVYVKDPKDVCCQLELCDVTLDDHEQQ 718
            |.|.:|   |...|.|...     .||||......||.|        .||:  :|          
Human    20 KVRTQL---CPTPCTCPWP-----PPRCPLGVPLVLDGC--------GCCR--VC---------- 56

  Fly   719 PTPLQSNNNEDPEEIDPFRFQEQARDAGGAKPTCTFKGAEYDVGQQFRDGCDQLCICN-EQGIHC 782
                                   ||..|                    :.||||.:|: .||:.|
Human    57 -----------------------ARRLG--------------------EPCDQLHVCDASQGLVC 78

  Fly   783 AKLECPSNFGLDVQDPHCIRWEPVPADFKPSPPNCCPESMRCVDNGTCSYQGVQIENWSPVPANL 847
            .....|...|     ..|:..|               :...|..||....:|   |.:.|     
Human    79 QPGAGPGGRG-----ALCLLAE---------------DDSSCEVNGRLYREG---ETFQP----- 115

  Fly   848 TGCDQHCYCENGRVECRAACPPVPALPPADLPCHPALARLLPIPDDECCKHWMCA---------- 902
             .|...|.||:|...|...|.....||..|.| ||....:|    .:||..|:|.          
Human   116 -HCSIRCRCEDGGFTCVPLCSEDVRLPSWDCP-HPRRVEVL----GKCCPEWVCGQGGGLGTQPL 174

  Fly   903 -PQIPKIGGAGQDEETEATSTHSSIPANETTT------TTATANKSTSIPSKVPQIKKDEEKR-- 958
             .|.|:..|.       .:|....:|..|.:|      ||.....:|.:.::....:.:.::|  
Human   175 PAQGPQFSGL-------VSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLC 232

  Fly   959 -----PPASG 963
                 ||:.|
Human   233 LSRPCPPSRG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 12/72 (17%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
CCN5NP_001310299.1 IGFBP <44..78 CDD:306685 16/96 (17%)
VWC 100..160 CDD:327433 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.