DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and CCN6

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_003871.1 Gene:CCN6 / 8838 HGNCID:12771 Length:354 Species:Homo sapiens


Alignment Length:400 Identity:81/400 - (20%)
Similarity:113/400 - (28%) Gaps:148/400 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 CCRVMECSEPQLEPTVVATEGAAPSTNGTGESAVTLPTTDD------EATPKPRTDCHYNSGVYK 654
            ||||                      .|||    .|.||.:      ...|:.:..||:.     
Human    18 CCRV----------------------QGTG----PLDTTPEGRPGEVSDAPQRKQFCHWP----- 51

  Fly   655 FRERLEIGCEQICHCAEGGVMDCRPRCPERNHTRLDKC----VYVKDPKDVCCQLELCDVTLDDH 715
                        |.|.:.     :||||.......|.|    :..|.|.::|.:.:||       
Human    52 ------------CKCPQQ-----KPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLC------- 92

  Fly   716 EQQPTPLQSNNNEDPEE-------IDPFRFQEQARDAGGAKPTCTFKGAEYDVGQQFRDGCDQLC 773
                         ||.:       :|..|: |....|......|.|....|..||.|:......|
Human    93 -------------DPHKGLYCDYSVDRPRY-ETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSC 143

  Fly   774 ICNEQGIHCAKLECPSNFGLDVQDPHCIRWEPVPADFKPSPPNCCPESMRCVDNGTCSYQG---- 834
            :|....|.|..|..|...|     .||   .......|....||..|.:  :...:.||:.    
Human   144 LCVSGAIGCTPLFIPKLAG-----SHC---SGAKGGKKSDQSNCSLEPL--LQQLSTSYKTMPAY 198

  Fly   835 ------------VQIENWSPVPANLTGCDQHCYC--------ENGRVECR---AACPPVPALPPA 876
                        ||...|:|       |.:.|..        ||...|.|   ..|        .
Human   199 RNLPLIWKKKCLVQATKWTP-------CSRTCGMGISNRVTNENSNCEMRKEKRLC--------Y 248

  Fly   877 DLPCHPALARLLPIPDDECCKHWMCAPQIPKIGGAGQDEETEATSTHSSIPANETTTTTATANKS 941
            ..||...:.:.:.||..:.|:......:..|...:|      .:||.|..|    |......:|.
Human   249 IQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVFSG------CSSTQSYKP----TFCGICLDKR 303

  Fly   942 TSIPSKVPQI 951
            ..||:|...|
Human   304 CCIPNKSKMI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 19/71 (27%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
CCN6NP_003871.1 IGFBP 48..100 CDD:365955 17/93 (18%)
GHB_like 275..341 CDD:389804 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.