DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn3

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_110495.1 Gene:Ccn3 / 81526 RGDID:621553 Length:351 Species:Rattus norvegicus


Alignment Length:206 Identity:59/206 - (28%)
Similarity:83/206 - (40%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 PTCTFKGAEYDVGQQFRDGCDQLCIC-NEQGIHCAKLE-CPSNFGLDVQDPHCIRWEPVPADFKP 812
            |||. .|.     :...|||....:| .::|..|:::. |..:.||     :|.|    .||   
  Rat    42 PTCA-PGV-----RSVLDGCSCCPVCARQRGESCSEMRPCDQSSGL-----YCDR----SAD--- 88

  Fly   813 SPPN-----C-CPESMRCVDNGTCSYQGVQIENWSPVPANLTGCDQHCYCENGRVECRAACPPVP 871
              ||     | .||...||.:|.....|   |.:.|      .|..||.|.:|::.|...|....
  Rat    89 --PNNETGICMVPEGDNCVFDGVIYRNG---EKFEP------NCQYHCTCRDGQIGCVPRCQLDV 142

  Fly   872 ALPPADLPCHPALARLLPIPDDECCKHWMC-APQIPKIGG----AGQDEETEATS-THSSIPANE 930
            .||..|.|....:|    :| .|||:.|.| :.:...:||    |.:.|.|.... :.|||...|
  Rat   143 LLPGPDCPAPKKVA----VP-GECCEKWTCGSEEKGTLGGLALPAYRPEATVGVELSDSSINCIE 202

  Fly   931 TTTTTATANKS 941
            .||..:..:||
  Rat   203 QTTEWSACSKS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 20/79 (25%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn3NP_110495.1 IB 28..97 CDD:197525 19/74 (26%)
VWC 104..164 CDD:214564 22/73 (30%)
CT 263..332 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.