Sequence 1: | NP_001262337.1 | Gene: | sas / 40861 | FlyBaseID: | FBgn0002306 | Length: | 1693 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_110495.1 | Gene: | Ccn3 / 81526 | RGDID: | 621553 | Length: | 351 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 59/206 - (28%) |
---|---|---|---|
Similarity: | 83/206 - (40%) | Gaps: | 48/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 750 PTCTFKGAEYDVGQQFRDGCDQLCIC-NEQGIHCAKLE-CPSNFGLDVQDPHCIRWEPVPADFKP 812
Fly 813 SPPN-----C-CPESMRCVDNGTCSYQGVQIENWSPVPANLTGCDQHCYCENGRVECRAACPPVP 871
Fly 872 ALPPADLPCHPALARLLPIPDDECCKHWMC-APQIPKIGG----AGQDEETEATS-THSSIPANE 930
Fly 931 TTTTTATANKS 941 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sas | NP_001262337.1 | VWC | 752..824 | CDD:214564 | 20/79 (25%) |
fn3 | 1413..1479 | CDD:278470 | |||
FN3 | 1516..1605 | CDD:238020 | |||
Ccn3 | NP_110495.1 | IB | 28..97 | CDD:197525 | 19/74 (26%) |
VWC | 104..164 | CDD:214564 | 22/73 (30%) | ||
CT | 263..332 | CDD:214482 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11348 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |