DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and ccn6

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001159703.1 Gene:ccn6 / 794092 ZFINID:ZDB-GENE-041001-86 Length:338 Species:Danio rerio


Alignment Length:322 Identity:67/322 - (20%)
Similarity:104/322 - (32%) Gaps:99/322 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 CEQICHCAEGGVMDCRPRCPERNHTRLDKC----VYVKDPKDVCCQLELCD----VTLDDHEQQP 719
            |...|.|   ||   ||.|.....:.||.|    ...:...:.|.:.::||    :..|..:.||
Zfish    34 CSWPCKC---GV---RPLCAPGVSSILDGCGCCKTCAQQIGESCNERDICDPHKSMYCDFSKDQP 92

  Fly   720 TPLQSNNNEDPEEIDPFRFQ----EQARDAGGAKPTCTFKGAEYDVGQQFRDGCDQLCICNEQGI 780
                             |::    ......|     |...||.||.||.|:......|.|....|
Zfish    93 -----------------RYEVGICAYLMGVG-----CDLNGAHYDNGQAFQPNPLYKCTCISGSI 135

  Fly   781 HC--AKLECPSNFGLDVQDPHCIRWEPVPADFKPS--PPNCCPESMRCVDNGTCSYQG------- 834
            .|  |.::.|:.    :..|..::.: :||..|.|  |.|....:.|.:.    :|:.       
Zfish   136 GCTPAFIQKPTG----MLSPAALQGQ-LPAGLKSSRNPKNQQDTTYRTMS----AYRDPPLAWKK 191

  Fly   835 ---VQIENWSPVPANLTGCDQHC------YCENGRVEC-----RAACPPVPALPPADLPCHPALA 885
               ||...|||       |.:.|      ...|...:|     |..|        ...||.....
Zfish   192 NCLVQTTAWSP-------CSRSCGIGISVRVNNDNSKCEMRKERRLC--------LLRPCDKNTL 241

  Fly   886 RLLPIPDDECCKHWMCAPQIPKIGGAGQDEETEATSTHSSIPANETTTTTATANKSTSIPSK 947
            :.|.:|..:.||....|.:..|:..:|          .:|:..:..|......:|...:|:|
Zfish   242 KRLKMPKGKTCKPKFQASKAEKLSLSG----------CTSVKKHRPTYCGVCTDKRCCVPNK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 21/75 (28%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
ccn6NP_001159703.1 IGFBP 34..79 CDD:278641 13/50 (26%)
GHB_like 259..326 CDD:304424 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.