DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn4

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_113904.2 Gene:Ccn4 / 65154 RGDID:69431 Length:367 Species:Rattus norvegicus


Alignment Length:264 Identity:54/264 - (20%)
Similarity:75/264 - (28%) Gaps:91/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 CEQICHCAEGGVMDCRPRCPERNHTRLDKCVYVKDPKDVCCQLELCDVTLDDHEQQPTPLQSNNN 727
            |:..|.|.:     ..||||.......|.|        .||  ::|...|.|           |.
  Rat    49 CKWPCECPQ-----APPRCPLGVSLITDGC--------ECC--KICAQQLGD-----------NC 87

  Fly   728 EDPEEIDPFRFQEQARDAGGAKPT-------------CTFKGAEYDVGQQFRDGCDQLCICNEQG 779
            .:....||.|  ....|..|.:|.             |...|..|..|:.|:..|...|.|.:..
  Rat    88 TEAAVCDPHR--GLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYTNGESFQPNCRYNCTCIDGT 150

  Fly   780 IHCAKLEC--PSNFGLDVQDPHCIRWEPVPADFKPSPPNCC-----------PESMRCVDNGTCS 831
            :.|..| |  |....|..:.|..:|          .|..||           |.....:|....:
  Rat   151 VGCTPL-CLSPRPPRLWCRQPRHVR----------VPGQCCEQWVCDDDARRPRQTALLDTRAFA 204

  Fly   832 YQGV---QIEN-------WSP--------VPANLTGCDQHCYCENGRVECRAACPPVPALPPADL 878
            ..|.   :.||       |||        :...::..:..|:.|.....|.        |.|.|:
  Rat   205 ASGAVEQRYENCIAYTSPWSPCSTTCGLGISTRISNVNARCWPEQESRLCN--------LRPCDV 261

  Fly   879 PCHP 882
            ...|
  Rat   262 DIRP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 19/84 (23%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn4NP_113904.2 IGFBP 49..101 CDD:395164 18/79 (23%)
VWC 123..181 CDD:214564 17/68 (25%)
TSP1_CCN 216..259 CDD:408805 7/50 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.