DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn2

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_071602.1 Gene:Ccn2 / 64032 RGDID:621392 Length:347 Species:Rattus norvegicus


Alignment Length:404 Identity:83/404 - (20%)
Similarity:120/404 - (29%) Gaps:152/404 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 RDCDERCTCNRGDWMCEPRCRGLSYPRGSQRSMANPNCLEKMVEEDECCRVMECSEPQLEPTVVA 613
            :||..:|.|..   ...|||     |.|.  |:....|        .||||  |::...|   :.
  Rat    25 QDCSAQCQCAA---EAAPRC-----PAGV--SLVLDGC--------GCCRV--CAKQLGE---LC 66

  Fly   614 TEG-------------AAPSTNGTGESAVTLPTTDDEATPKPRTDCHYNSGVYKFRERLEIGCEQ 665
            ||.             .:|:....|           ..|.|....|.:...||:..|..:..|:.
  Rat    67 TERDPCDPHKGLFCDFGSPANRKIG-----------VCTAKDGAPCVFGGSVYRSGESFQSSCKY 120

  Fly   666 ICHCAEGGV-------MDCR---PRCPERNHTRLDKCVYVKDPKDVCCQLELCDVTLDDHEQQPT 720
            .|.|.:|.|       ||.|   |.||.....:|         ...||:..:||        :| 
  Rat   121 QCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKL---------PGKCCEEWVCD--------EP- 167

  Fly   721 PLQSNNNEDPEEIDPFRFQEQARDAGGAKPT-----CTFKGAEYDVGQQFRDGCDQLCICNEQGI 780
                   :|...:.|.....:..|..|..||     |..:..|:       ..|.:.|   ..||
  Rat   168 -------KDRTVVGPALAAYRLEDTFGPDPTMMRANCLVQTTEW-------SACSKTC---GMGI 215

  Fly   781 HCAKLECPSNFGLDVQDPHCIRWEPVPADFKPSPPNCCPESMRCVDNGTCSYQGVQIENWSPVPA 845
            ........:...|:.|...|: ..|..||.:.:    ..:..:|:.....:         .||..
  Rat   216 STRVTNDNTFCRLEKQSRLCM-VRPCEADLEEN----IKKGKKCIRTPKIA---------KPVKF 266

  Fly   846 NLTGCD-------QHC-YCENGRVECRAACPPVPALPPADLPCHPALARLLPI----PDDE---- 894
            .|:||.       :.| .|.:||      |            |.|.....||:    ||.|    
  Rat   267 ELSGCTSVKTYRAKFCGVCTDGR------C------------CTPHRTTTLPVEFKCPDGEIMKK 313

  Fly   895 -------CCKHWMC 901
                   |..|:.|
  Rat   314 NMMFIKTCACHYNC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 12/71 (17%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn2NP_071602.1 IGFBP <39..80 CDD:395164 15/60 (25%)
VWC 101..160 CDD:214564 17/67 (25%)
TSP1_CCN 197..240 CDD:408805 9/53 (17%)
Heparin-binding. /evidence=ECO:0000250|UniProtKB:P29279 245..347 21/114 (18%)
GHB_like 251..343 CDD:419725 21/104 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11348
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.