DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn6

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001163954.1 Gene:Ccn6 / 499461 RGDID:1564120 Length:354 Species:Rattus norvegicus


Alignment Length:421 Identity:85/421 - (20%)
Similarity:119/421 - (28%) Gaps:164/421 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 CCRVMECSEPQLEPTVVATEGAAPSTNGTGESAVTLPTTDDEATPKPRTDCHYNSGVYKFRERLE 660
            |||......|          ||.|.    |:....|.                   ||:.:|   
  Rat    18 CCRAQGSVPP----------GATPG----GQPGAALE-------------------VYQRKE--- 46

  Fly   661 IGCEQICHCAEGGVMDCR-----PRCPERNHTRLDKC----VYVKDPKDVCCQLELCDVTLDDHE 716
                 :||      ..||     |.||.......|.|    :..|.|.|:|.:.|.|        
  Rat    47 -----VCH------WPCRCPPQVPTCPPGVSLVRDGCGCCKICAKQPGDICNEAESC-------- 92

  Fly   717 QQPTPLQSNNNEDPEEIDPFR--FQEQARDAGGAKPT-------------CTFKGAEYDVGQQFR 766
                             ||.:  :.:.:||    ||.             |.|.|..|..||.|:
  Rat    93 -----------------DPHKGLYCDYSRD----KPRYETGVCAYLVAVGCEFNGVHYQNGQVFQ 136

  Fly   767 DGCDQLCICNEQGIHCAKL--------ECPS-NFGLDVQDPHCIRWEP----------VPADFKP 812
            ......|:|....|.|..|        .|.| ..|..:..|.|.:..|          :|| ::.
  Rat   137 PHPLFSCLCVSGAIGCTPLFRPKLAGSNCSSARGGRKIDPPDCGQGSPQQGRSAGYRTMPA-YRN 200

  Fly   813 SPPNCCPESMRCVDNGTCSYQGVQIENWSP--------VPANLTGCDQHCYCENGRVECRAACPP 869
            .||..   ..:|:         ||...|:|        :...:|..:.:|...|.:..|...   
  Rat   201 LPPTW---KKKCL---------VQATRWTPCSRTCGMGISNRVTNDNSNCEMRNEKRLCYIQ--- 250

  Fly   870 VPALPPADLPCHPALARLLPIPDDECCKHWMCAPQIPKIGGAGQDEETEATSTHSSIPANETTTT 934
                     ||.....:...||..|.|:...   |:||       .|....|..||......|..
  Rat   251 ---------PCGRKPWKAGKIPRGETCQPTF---QLPK-------AEKFVFSGCSSAQTYRPTFC 296

  Fly   935 TATANKSTSIPSKVPQIKKDEEKRPPASGAF 965
            ....:|...:|:|...|....:  .|..|:|
  Rat   297 GICLDKRCCVPNKSTMITVRFD--CPGEGSF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 22/90 (24%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn6NP_001163954.1 IGFBP 48..100 CDD:278641 17/82 (21%)
GHB_like 275..342 CDD:304424 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.