Sequence 1: | NP_001262337.1 | Gene: | sas / 40861 | FlyBaseID: | FBgn0002306 | Length: | 1693 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002505.1 | Gene: | CCN3 / 4856 | HGNCID: | 7885 | Length: | 357 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 55/206 - (26%) |
---|---|---|---|
Similarity: | 79/206 - (38%) | Gaps: | 48/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 750 PTCTFKGAEYDVGQQFRDGCDQLCIC-NEQGIHCAKLE-CPSNFGLDVQDPHCIRWEPVPADFKP 812
Fly 813 SPPN---CCPESMRCVDNGTCSYQGV---QIENWSPVPANLTGCDQHCYCENGRVECRAACPPVP 871
Fly 872 ALPPADLPCHPALARLLPIPDDECCKHWMCAP-QIPKIGG----AGQDEETEATS-THSSIPANE 930
Fly 931 TTTTTATANKS 941 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sas | NP_001262337.1 | VWC | 752..824 | CDD:214564 | 18/76 (24%) |
fn3 | 1413..1479 | CDD:278470 | |||
FN3 | 1516..1605 | CDD:238020 | |||
CCN3 | NP_002505.1 | IB | 33..>95 | CDD:197525 | 17/65 (26%) |
VWC | 110..170 | CDD:214564 | 19/70 (27%) | ||
CT | 269..338 | CDD:214482 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11348 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |