DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and CCN3

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_002505.1 Gene:CCN3 / 4856 HGNCID:7885 Length:357 Species:Homo sapiens


Alignment Length:206 Identity:55/206 - (26%)
Similarity:79/206 - (38%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 PTCTFKGAEYDVGQQFRDGCDQLCIC-NEQGIHCAKLE-CPSNFGLDVQDPHCIRWEPVPADFKP 812
            |||. .|.     :...|||....:| .::|..|:.|| |..:.||     :|        |...
Human    48 PTCA-PGV-----RAVLDGCSCCLVCARQRGESCSDLEPCDESSGL-----YC--------DRSA 93

  Fly   813 SPPN---CCPESMRCVDNGTCSYQGV---QIENWSPVPANLTGCDQHCYCENGRVECRAACPPVP 871
            .|.|   .|    ..|:...|.:.||   ..|.:.|      .|...|.|.:|::.|...|....
Human    94 DPSNQTGIC----TAVEGDNCVFDGVIYRSGEKFQP------SCKFQCTCRDGQIGCVPRCQLDV 148

  Fly   872 ALPPADLPCHPALARLLPIPDDECCKHWMCAP-QIPKIGG----AGQDEETEATS-THSSIPANE 930
            .||..:.|.    .|.:.:| .|||:.|:|.| :...:||    |.:.|.|.... :.||:...|
Human   149 LLPEPNCPA----PRKVEVP-GECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIE 208

  Fly   931 TTTTTATANKS 941
            .||.....:||
Human   209 QTTEWTACSKS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 18/76 (24%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
CCN3NP_002505.1 IB 33..>95 CDD:197525 17/65 (26%)
VWC 110..170 CDD:214564 19/70 (27%)
CT 269..338 CDD:214482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.