DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_730294.1 Gene:Ccn / 39972 FlyBaseID:FBgn0052183 Length:470 Species:Drosophila melanogaster


Alignment Length:221 Identity:53/221 - (23%)
Similarity:80/221 - (36%) Gaps:70/221 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 PSPPNCCPESMRCVDNGTCSYQGVQIENWSPVPANLTGCDQHCYCENGRVECRAACP--PVPALP 874
            |:|.||      .|.|.|.:: ||..:         ..|...|.|||||..|...||  .:|| |
  Fly    36 PNPANC------SVGNTTFAH-GVTFK---------LDCKTQCVCENGRHACSTLCPNEQLPA-P 83

  Fly   875 PADLPCHPALARLLPIPDDECCKHWMCAPQIPKIGGAGQDEETEATSTHSSIPANETTTTTA--- 936
            ...:.|..  .||:.:| ..|||.|:|         .....:..||..:|:...|.|..:.:   
  Fly    84 EDTISCRS--PRLVEVP-GHCCKMWLC---------ENPTADVYATCHNSTTSGNWTACSRSCGL 136

  Fly   937 -TANKSTSIPSKVPQIK-----------KDEEKRPPASGAFYPTLDGKPPKSIGGLGIFEKPEKP 989
             ||.:.|:..:...|:.           ||:.:            |.|..:|           :|
  Fly   137 GTATRHTTTHAGCHQLSNLRLCENRRCDKDDHE------------DNKWSRS-----------RP 178

  Fly   990 EKAHKKVQHQQQQHQQQEQQEQQQHQ 1015
             ..||:.||:...|..|.....::|:
  Fly   179 -LTHKRKQHRAHSHSHQRYHHHKEHE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 4/11 (36%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
CcnNP_730294.1 VWC 41..104 CDD:302663 25/82 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.