DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn6

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001120848.1 Gene:Ccn6 / 327743 MGIID:2685581 Length:354 Species:Mus musculus


Alignment Length:413 Identity:86/413 - (20%)
Similarity:122/413 - (29%) Gaps:148/413 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 CCRVMECSEPQLEPTVVATEGAAPSTNGTGESAVTLPTTDDEATPKPRTDCHYNSGVYKFRERLE 660
            |||               |:|:||                .::||..|......  ||   :|.|
Mouse    18 CCR---------------TQGSAP----------------QDSTPGGRPGAALE--VY---QRTE 46

  Fly   661 IGCEQICHCAEGGVMDCRPRCPERNHTRLDKC----VYVKDPKDVCCQLELCDVTLDDHEQQPTP 721
            : |...|.|...     ||.||.......|.|    |..|.|.|.|.:.|:|    |.|:.... 
Mouse    47 V-CRWPCRCPPQ-----RPTCPPGVSLVRDGCGCCKVCAKQPGDTCNEAEIC----DPHKGLYC- 100

  Fly   722 LQSNNNEDPEEIDPFRFQEQARDAGGAKPT-------------CTFKGAEYDVGQQFRDGCDQLC 773
                                  |..|..|.             |.|....|..||.|:......|
Mouse   101 ----------------------DYSGDTPRYETGVCAYLVAVGCEFNRVYYQNGQVFQPHPLFSC 143

  Fly   774 ICNEQGIHCAKLECPSNFGLDVQDPHCIRWEPVPADFKPSPPNCCPESMRCVDNGTCSYQG---- 834
            :|....|.|..|..|...|.:.......|        |..||||...:::  ...:.||:.    
Mouse   144 LCVSGAIGCTPLFIPKLAGSNCSAAKGRR--------KTDPPNCGRGTLQ--QQNSASYKTMSAY 198

  Fly   835 ------------VQIENWSP--------VPANLTGCDQHCYCENGRVECRAACPPVPALPPADLP 879
                        ||...|:|        :...:|..:.:|.....|..|...            |
Mouse   199 RNLPLTWRKKCLVQATKWTPCSRTCGMGISNRVTNDNANCEMRKERRLCYIQ------------P 251

  Fly   880 CHPALARLLPIPDDECCKHWMCAPQIPKIGGAGQDEETEATSTHSSIPANETTTTTATANKSTSI 944
            |....::.:.||..|.|:.....|:..|...:|      .:||.|..|    |......:|...:
Mouse   252 CSRNTSQAVKIPRGETCQPTFQLPKAEKFVFSG------CSSTQSYRP----TFCGICLDKRCCV 306

  Fly   945 P--SKVPQIKKDEEKRPPASGAF 965
            |  ||:..::.|    .|:.|:|
Mouse   307 PNKSKMITVRFD----CPSEGSF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 19/71 (27%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn6NP_001120848.1 IGFBP 48..100 CDD:395164 18/60 (30%)
TSP1_CCN 209..252 CDD:408805 8/54 (15%)
GHB_like 275..341 CDD:419725 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.