DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and ccn2a

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_001015041.1 Gene:ccn2a / 321449 ZFINID:ZDB-GENE-030131-102 Length:345 Species:Danio rerio


Alignment Length:336 Identity:78/336 - (23%)
Similarity:119/336 - (35%) Gaps:92/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 CEQICHCAEGGVMDCRPRCPERNHTRLDKC----VYVKDPKDVCCQLELCDVTLDDHEQQPTPLQ 723
            |...|||.|     ..|:|.......||.|    |..|...::|.:.::|    |.|:.......
Zfish    26 CSGQCHCPE-----VPPQCSPGVSLVLDTCGCCRVCAKQLGELCTERDVC----DPHKGLYCDYG 81

  Fly   724 SNNNEDPEEIDPFRFQE-QARDAGGAKPTCTFKGAEYDVGQQFRDGCDQLCICNEQGIHCAKLEC 787
            |.:|.        |... .|||  ||  ||.|.|..|..|:.|:..|...|.|.:..:.|..| |
Zfish    82 SPSNR--------RIGVCTARD--GA--TCVFGGMVYRSGESFQSSCKYQCTCLDGAVGCVPL-C 133

  Fly   788 PSNFGLDVQ--DPHCIRWEPVPADFKPSPPNCC-------PESMRCVDNGTCSYQGVQIENWSPV 843
                |:|::  .|.|    |:|...| .|..||       |.....|.:...:|:  :.|.:.|.
Zfish   134 ----GMDIRLPSPDC----PMPRRVK-VPGKCCEEWVCDSPRQNTFVGSALAAYR--EEETYGPD 187

  Fly   844 PANL-----------TGCDQHC------YCENGRVECR-----AACPPVPALPPADLPCHPALAR 886
            |:.:           :.|.:.|      ...|...|||     ..|        ...||...|  
Zfish   188 PSMMRENCLVQTTEWSACSKTCGLGISTRVTNDNRECRLEKQSRLC--------MVRPCESHL-- 242

  Fly   887 LLPIPDDECCKHWMCAPQIPKIGGAGQDEETEATSTHSSIP---ANETTTTTATANKSTSIPS-- 946
                 :::..|...|. :.|::....:.|.:..|:|.|..|   ...|.....|.:::.::|.  
Zfish   243 -----EEKIRKGKKCI-RTPRVSKPMKFEISGCTTTKSYRPKFCGVCTDGRCCTPHRTATLPMEF 301

  Fly   947 KVP--QIKKDE 955
            |.|  |:.|.:
Zfish   302 KCPDGQVMKKQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 23/80 (29%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
ccn2aNP_001015041.1 IGFBP 26..78 CDD:278641 16/60 (27%)
VWC 99..158 CDD:214564 21/68 (31%)
TSP1 198..239 CDD:214559 8/48 (17%)
GHB_like 249..340 CDD:304424 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.