DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn5

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_113778.2 Gene:Ccn5 / 29576 RGDID:621867 Length:250 Species:Rattus norvegicus


Alignment Length:277 Identity:68/277 - (24%)
Similarity:93/277 - (33%) Gaps:118/277 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 LEIGCEQICH--CAEGGVMDC---RPRCPERNHTRLDKCVYVKDPKDVCCQL------ELCD-VT 711
            |.:.|.|:|.  |.      |   .|:||:.....||.|        .||::      |.|| :.
  Rat    18 LSMVCAQLCRTPCT------CPWTPPQCPQGVPLVLDGC--------GCCKVCARRLGESCDHLH 68

  Fly   712 LDDHEQ----QPTPLQSNNNEDPEEIDPFRFQEQARDAGGAKP--------------TCTFKGAE 758
            :.|..|    ||                           ||.|              :|...|..
  Rat    69 VCDPSQGLVCQP---------------------------GAGPGGHGAVCLLDEDDGSCEVNGRR 106

  Fly   759 YDVGQQFRDGCDQLCICNEQGIHCAKLECPSNFGLDVQDPHCIRWE-PVPADFKPSPPNCCPESM 822
            |..|:.|:..|..||.|::.|..|..| |..    ||:.|   .|: |.|...: .|..||||.:
  Rat   107 YLDGETFKPNCRVLCRCDDGGFTCLPL-CSE----DVRLP---SWDCPRPKRIQ-VPGRCCPEWV 162

  Fly   823 RCVDNGT------CSYQGVQIE-------------NWSPV--PANLTGC---------DQHCYCE 857
             | |.|.      .:.||.|:.             |||..  |.:.| |         :|:.:|:
  Rat   163 -C-DQGVTPAIQRSTAQGHQLSALVTPASADAPCPNWSTAWGPCSTT-CGLGIATRVSNQNRFCQ 224

  Fly   858 NGRVEC-RAACPPVPAL 873
               :|. |..|.|.|.|
  Rat   225 ---LEIQRRLCLPRPCL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 24/72 (33%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn5NP_113778.2 IGFBP 26..78 CDD:395164 16/65 (25%)
VWC 100..159 CDD:327433 21/67 (31%)
TSP1_CCN 194..237 CDD:408805 12/46 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.