DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sas and Ccn5

DIOPT Version :9

Sequence 1:NP_001262337.1 Gene:sas / 40861 FlyBaseID:FBgn0002306 Length:1693 Species:Drosophila melanogaster
Sequence 2:NP_058569.2 Gene:Ccn5 / 22403 MGIID:1328326 Length:251 Species:Mus musculus


Alignment Length:252 Identity:61/252 - (24%)
Similarity:79/252 - (31%) Gaps:88/252 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 CEQICHCAEGGVMDCRPRCPERNHTRLDKCVYVKDPKDVCCQL------ELCD-VTLDDHEQ--- 717
            |...|.|..     ..|:||......||.|        .||::      |.|| :.:.|..|   
Mouse    26 CPAPCACPW-----TPPQCPPGVPLVLDGC--------GCCRVCARRLGESCDHLHVCDPSQGLV 77

  Fly   718 -QPTPLQSNNNEDPEEIDPFRFQEQARDAGGAKPTCTFKGAEYDVGQQFRDGCDQLCICNEQGIH 781
             ||....|....      ...|:|   |.|    :|...|..|..|:.|:..|..||.|::.|..
Mouse    78 CQPGAGPSGRGA------VCLFEE---DDG----SCEVNGRRYLDGETFKPNCRVLCRCDDGGFT 129

  Fly   782 CAKLECPSNFGLDVQDPHCIRWE-PVPADFKPSPPNCCPESMRCVDNGTCSYQGVQIENWSPVPA 845
            |..| |..    ||:.|   .|: |.|...: .|..||||                   |.    
Mouse   130 CLPL-CSE----DVRLP---SWDCPRPRRIQ-VPGRCCPE-------------------WV---- 162

  Fly   846 NLTGCDQHCYCENGRVECRAACPPVPALPPADLPCHPALARLLPIPDDECCKHWMCA 902
                |||              ....||:.|:....|...|.:.|...|..|.:|..|
Mouse   163 ----CDQ--------------AVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sasNP_001262337.1 VWC 752..824 CDD:214564 24/72 (33%)
fn3 1413..1479 CDD:278470
FN3 1516..1605 CDD:238020
Ccn5NP_058569.2 IGFBP 26..78 CDD:278641 16/64 (25%)
VWC 100..159 CDD:214564 21/67 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11348
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.